Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate PP_2784 PP_2784 Oxidoreductase, short-chain dehydrogenase/reductase family
Query= reanno::Burk376:H281DRAFT_00644 (263 letters) >FitnessBrowser__Putida:PP_2784 Length = 254 Score = 134 bits (338), Expect = 1e-36 Identities = 92/255 (36%), Positives = 137/255 (53%), Gaps = 19/255 (7%) Query: 13 LRVFVSAGAA-GIGLAIAEAFIEAQAE--VYICDVNQAAID------EATSRFPKLHAGI 63 LR V GAA GIG A+AE+F AQAE + + D + A + E +R A I Sbjct: 4 LRTIVITGAANGIGRAVAESFA-AQAEHLLILLDRDLATLQGWVTEGEFAARIETHQANI 62 Query: 64 ADVSKQAQVDQIIDDARRKLGGLDVLVNNAGIAGPTGAVEELDPAQWESTVSTNLNSQFY 123 AD+ A + + ++G +DVLVN+AG+ E+LD W +S NLN FY Sbjct: 63 ADL---ASLQLLFKGLADRVGFVDVLVNSAGVCDENEP-EDLD--NWHKVISINLNGTFY 116 Query: 124 FLRKAVPVLKETSDCASIIAMSSVAGRLGYPFRTPYASTKWAIVGLVKSLAAELGPSNVR 183 +P++ +D I+ MSS+ GR G T Y ++K I+G+ K+LA +L P + Sbjct: 117 VTSLCLPLM---ADGGRIVNMSSILGRAGKVRNTAYCASKHGIIGMTKALALDLAPRRIT 173 Query: 184 VNAILPGVVEGERMDRVISARADALGIPFNAMREEYLKKISLRRMVTVDDIAAMALFLAS 243 VNAILP ++ + ++A+A GI + KK+ LRR + D++AAM +LAS Sbjct: 174 VNAILPAWIDTPMLQGELAAQARIAGITHEQILRNAKKKLPLRRFIQGDEVAAMVRYLAS 233 Query: 244 PAGSNVTGQAISVDG 258 P S VT Q++ +DG Sbjct: 234 PQASGVTAQSLMIDG 248 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 111 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 254 Length adjustment: 24 Effective length of query: 239 Effective length of database: 230 Effective search space: 54970 Effective search space used: 54970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory