Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate PP_1484 PP_1484 predicted polyamine ABC transporter, ATP-binding protein
Query= TCDB::Q97UF2 (371 letters) >FitnessBrowser__Putida:PP_1484 Length = 343 Score = 185 bits (470), Expect = 1e-51 Identities = 100/236 (42%), Positives = 147/236 (62%), Gaps = 7/236 (2%) Query: 19 EVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTSGYIYFDN-EAVSSPRRV 77 EVKAVD VSI I G F +LGPSG GKTT LRLIAG E+P+SG I EA P Sbjct: 16 EVKAVDQVSIDIIDGEFFSMLGPSGSGKTTCLRLIAGFEQPSSGSIRIQGVEAAGLP--- 72 Query: 78 MMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIENKVKEVSEELGLSGVLN 137 P +R + VFQ++AL+P+M V +NIA+ LK+ V K + ++ +E + L+G Sbjct: 73 ---PYQRDVNTVFQDYALFPHMNVLENIAYGLKVKGVGKAERHSRAEEALAMVALAGYGA 129 Query: 138 RYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRESARALVRKIQRERKLTTL 197 R P +LSGGQ QR A+ARALV P+VLLLDEP LD ++RE + ++K+QR+ +T + Sbjct: 130 RKPAQLSGGQRQRVALARALVNRPRVLLLDEPLGALDLKLREQMQGELKKLQRQLGITFI 189 Query: 198 IVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIARLTGEINLIQAKI 253 V+HD + +++++ V G+ Q+ TP +Y P+T +A G N+++ ++ Sbjct: 190 FVTHDQTEALSMSDRVAVFNRGRIEQVDTPRNLYMKPSTTFVAEFVGTSNVVRGEL 245 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 343 Length adjustment: 29 Effective length of query: 342 Effective length of database: 314 Effective search space: 107388 Effective search space used: 107388 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory