Align ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale)
to candidate PP_2759 PP_2759 ribose ABC transporter - ATP-binding subunit
Query= uniprot:A0A0C4Y5F6 (540 letters) >FitnessBrowser__Putida:PP_2759 Length = 512 Score = 328 bits (842), Expect = 2e-94 Identities = 203/509 (39%), Positives = 287/509 (56%), Gaps = 15/509 (2%) Query: 12 PLLALRNICKTFPGVRALRKVELTAYAGEVHALMGENGAGKSTLMKILSGAYTADPGGEC 71 P+L LR I KTF RAL L AG VH L+GENGAGKSTL+K+L+G + D G Sbjct: 4 PVLELRGIVKTFGATRALDGASLRVAAGSVHGLVGENGAGKSTLIKVLAGIHRPD-AGSL 62 Query: 72 HIDGQRVQIDGPQSARDLGVAVIYQELSLAPNLSVAENIYLGRALQRRGLVARGDMVRAC 131 +DGQ P+ LG+ I+QE L +V E ++ G + L+ R R Sbjct: 63 LLDGQPHGHFSPRQVERLGIGFIHQERLLPARFTVGEALFFGHERRFGPLLDRRSQQREA 122 Query: 132 APTLAR-LGADFSPAANVASLSIAQRQLVEIARAVHFEARILVMDEPTTPLSTHETDRLF 190 A L G A + LS A++Q+V+I RA+ + R+LV DEP+ L E +RL Sbjct: 123 ARLLDDYFGLRLPANALIGELSSAEQQMVQIVRALLIKPRVLVFDEPSVALVQREVERLL 182 Query: 191 ALIRQLRGEGMAILYISHRMAEIDELADRVTVLRDGCFVGTLDRAHLSQAALVKMMVGRD 250 ++++LR +G+AI+YISH + EI+ L DRVTVLR+G V + + S + ++MV R+ Sbjct: 183 RIVQRLRDDGLAIVYISHYLQEIEALCDRVTVLRNGRDVAEVSPRNTSLEQITRLMVNRE 242 Query: 251 LSGFYTKTHGQAVEREVMLSVRDVADGRRVKGCSFDLRAGEVLGLAGLVGAGRTELARLV 310 + Y K A ++L VR + R +G +R GE++GL GLVG+G EL R + Sbjct: 243 VGELYPKVAVPA--GALLLDVRGLGRARAYQGIDLQVRRGEIVGLTGLVGSGAKELLRSL 300 Query: 311 FGADARTRGEVRIANPAGSGGLVTLPAGGPRQAIDAGIAYLTEDRKLQGLFLDQSVHENI 370 FG GEVR+ L PR+A+ G+A + E+R+ QG+ LD SV EN Sbjct: 301 FGLAPPDSGEVRLDGQP-------LSLRSPREAVAQGVALMPEERRRQGVALDLSVQENT 353 Query: 371 NLIVAARDALGLGRLNRTAARRRTTEAIDTLGIRVAHAQVNVGALSGGNQQKVMLSRLLE 430 L +R + LG L+ R T E I+ L I+ A V LSGGNQQKV L++ Sbjct: 354 TLAALSR-FVRLGLLSPARERHTTLELIERLRIKAHGAHAKVRQLSGGNQQKVALAKWFA 412 Query: 431 IQPRVLILDEPTRGVDIGAKSEIYRLINALAQSGVAILMISSELPEVVGLCDRVLVMREG 490 + +LDEP+ G+D+GAK EIYRLI L + G +L++SS+LPE++GLCDR+ VM G Sbjct: 413 RCSSLYLLDEPSVGIDVGAKVEIYRLIGELVKEGAGVLILSSDLPELIGLCDRIHVMHRG 472 Query: 491 TLAGEVRPAGSAAETQERIIALATGAAAA 519 +A AG A +R++A+ATGA A Sbjct: 473 AIAARF-AAGEA--NSDRLLAVATGAQRA 498 Lambda K H 0.320 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 664 Number of extensions: 38 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 540 Length of database: 512 Length adjustment: 35 Effective length of query: 505 Effective length of database: 477 Effective search space: 240885 Effective search space used: 240885 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory