GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fruII-ABC in Pseudomonas putida KT2440

Align The fructose porter, FruA (fructose-1-P forming IIABC) (Delobbe et al. 1975) FruA is 39% identical to 4.A.2.1.1). fructose can be metabolized to Fru-1-P via this system as well as Fru-6-P by another PTS system (characterized)
to candidate PP_0795 PP_0795 fructose PTS permease - IIBC component

Query= TCDB::P71012
         (635 letters)



>lcl|FitnessBrowser__Putida:PP_0795 PP_0795 fructose PTS permease -
           IIBC component
          Length = 580

 Score =  432 bits (1111), Expect = e-125
 Identities = 222/471 (47%), Positives = 320/471 (67%), Gaps = 18/471 (3%)

Query: 163 APAPAGKGKILAVTACPTGIAHTFMAADALKEKAKELGVEIKVETNGSSGIKHKLTAQEI 222
           A A +   +I+AVTACPTG+AHTFMAA+AL++ A++LG ++ VET GS G ++ L+A+ I
Sbjct: 111 AAASSAGARIVAVTACPTGVAHTFMAAEALQQAAQQLGYQLTVETQGSVGARNPLSAEAI 170

Query: 223 EDAPAIIVAADKQVEMERFKGKRVLQVPVTAGIRRPQELIEKAMNQDAPIYQGSGGGSAA 282
             A  +++AAD +V   RF GKR+ +      +++ +  ++KA+ Q A +  G+   +A 
Sbjct: 171 AAADVVLLAADIEVPTARFAGKRIYRCGTGIALKQARATLDKALAQ-ATVENGADAAAAT 229

Query: 283 SNDDEEAKGKSGSGIGNTFYKHLMSGVSNMLPFVVGGGILVAISFFWGIHSADPNDPSYN 342
           +    E  G          YKHL++GVS MLP VV GG+L+A+SF +GI +         
Sbjct: 230 TPTKSEKTG---------VYKHLLTGVSFMLPMVVAGGLLIALSFVFGIEAYK----EAG 276

Query: 343 TFAAALNFIGGDNALKLIVAVLAGFIAMSIADRPGFAPGMVGGFMATQANAGFLGGLIAG 402
           T  AAL  IGG+ A KL+V +LAG+IA SIADRPG APGM+GG +A+   AGF+GG++AG
Sbjct: 277 TLPAALMQIGGEAAFKLMVPLLAGYIAWSIADRPGLAPGMIGGLLASTLGAGFIGGIVAG 336

Query: 403 FLAGYVVILLKKVFTFIPQSLDGLKPVLIYPLFGIFITGVLMQFVVNTPVAAFMNFLTNW 462
           FLAGY    + + +  +P SL+ LKP+LI PL     TG++M +VV  PVAA +  LT++
Sbjct: 337 FLAGYSAKAIAR-WARLPSSLEALKPILIIPLLASLFTGLVMIYVVGQPVAAMLEGLTHF 395

Query: 463 LESLGTGNLVLMGIILGGMMAIDMGGPLNKAAFTFGIAMIDAGNYAPHAAIMAGGMVPPL 522
           L+S+GT N +L+G++LGGMM +D+GGP+NKAA+ F + ++ + +YAP AA MA GMVPP+
Sbjct: 396 LDSMGTTNAILLGLLLGGMMCVDLGGPINKAAYAFSVGLLASSSYAPMAATMAAGMVPPI 455

Query: 523 GIALATTIFRNKFTQRDREAGITCYFMGAAFVTEGAIPFAAADPLRVIPAAVVGAAVAGG 582
           G+ +AT + R KF Q +REAG     +G  F++EGAIPFAA DPLRVIPA++ G A+ G 
Sbjct: 456 GLGIATFLARRKFAQSEREAGKAALALGLCFISEGAIPFAAKDPLRVIPASIAGGALTGA 515

Query: 583 LTEFFRVTLPAPHGGVFVAFI---TNHPMLYLLSIVIGAVVMAIILGIVKK 630
           L+ +F   L APHGG+FV  I    NH +LYLL+IV G++V A++  ++KK
Sbjct: 516 LSMYFGCKLMAPHGGLFVLLIPNAINHALLYLLAIVAGSLVTAVVYAVIKK 566



 Score = 49.7 bits (117), Expect = 4e-10
 Identities = 34/132 (25%), Positives = 63/132 (47%), Gaps = 2/132 (1%)

Query: 172 ILAVTACPTGIAHTFMAADALKEKAKELGVEIKVETNGSSGIKHKLTAQEIEDAPAIIVA 231
           I  VTACP G   + ++A  L   A+  G    VE   +   + +L+A +I +A  ++V 
Sbjct: 3   IAIVTACPNGQVSSVLSARLLSAAAQRRGWSTSVEVQNTEHPERQLSAAQIAEADWVLVV 62

Query: 232 ADKQVEMERFKGKRVLQVPVTAGIRRPQELIEKAMNQDAPIYQGSGGGSAASNDDEE--A 289
           +   V++ RF GKR+ Q   +  +   +  +++A      +   +G  +AAS+      A
Sbjct: 63  STGPVDLARFVGKRLYQSTPSQALADREGFLDEAAANAELLAAVTGAPAAASSAGARIVA 122

Query: 290 KGKSGSGIGNTF 301
                +G+ +TF
Sbjct: 123 VTACPTGVAHTF 134


Lambda     K      H
   0.320    0.137    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 761
Number of extensions: 33
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 635
Length of database: 580
Length adjustment: 37
Effective length of query: 598
Effective length of database: 543
Effective search space:   324714
Effective search space used:   324714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory