Align Gluconolactonase (characterized, see rationale)
to candidate PP_3180 PP_3180 Smp-30/Cgr1 family protein
Query= uniprot:A0A165IRV8 (316 letters) >FitnessBrowser__Putida:PP_3180 Length = 346 Score = 135 bits (340), Expect = 1e-36 Identities = 96/289 (33%), Positives = 136/289 (47%), Gaps = 24/289 (8%) Query: 35 LGEGVLWSVREQAVYWVDILGRELHRWDPATGAHQRWTFDEEISAIAERAHAPGFIVTLR 94 LGE ++W R +Y+VDI G ++ P D E+ + E A G + Sbjct: 71 LGESLVWDERSGVLYFVDISGGRINGLTP----------DGEVDCLYESAARIGALALTD 120 Query: 95 RG---------FALFDPATDMAPRYLHQPEPDRAGNRFNDGKCDAQGRFWAGSMDFACEA 145 RG A+FD T ++ P R+ RFNDG CD QGRF G MD A Sbjct: 121 RGNLIFTEDASVAIFDVPTRKVSQHSASVHP-RSTYRFNDGACDPQGRFVTGLMDEALSD 179 Query: 146 PTGALYRYDSDGSCTRHDDGFAVTNGPTWSGTGQGAAMFFNATIEGNTYRYDSDLATGTV 205 TGAL+R+D S D + G WS G ++F + YR + L G + Sbjct: 180 NTGALFRFDWQLSDQVIHDDMGLPTGLAWSHDGH--TVYFVDSAARAIYRAEY-LIEGRL 236 Query: 206 SNKTLWKHWLPEDGLPDGMTTDAQGRLWIAHWGGWCVTCHDPVTAAELGRVRLPVSQVTT 265 TL+ E G PDG+ D +G LW+ + G C+ +D +V +PV T+ Sbjct: 237 GAVTLFAETPAELGRPDGLALDREGGLWVCQYHGSCLLRYDR-HGYLTDQVLMPVPCPTS 295 Query: 266 CAFGGADLRTLFISSARVGLTPEQLAAEPLAGALFAVDTDSLGLPAHPF 314 C FGG + TL+IS+AR +TPE L P AG L+A+ ++ G+ H F Sbjct: 296 CCFGGPGMNTLYISTARYDMTPEDLHHYPDAGDLYAIRPETGGVARHSF 344 Lambda K H 0.321 0.137 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 346 Length adjustment: 28 Effective length of query: 288 Effective length of database: 318 Effective search space: 91584 Effective search space used: 91584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory