Align Galactofuranose transporter permease protein YtfT (characterized)
to candidate PP_2456 PP_2456 D-ribose ABC transporter - permease subunit
Query= SwissProt::P39328 (341 letters) >FitnessBrowser__Putida:PP_2456 Length = 331 Score = 147 bits (371), Expect = 4e-40 Identities = 93/303 (30%), Positives = 163/303 (53%), Gaps = 13/303 (4%) Query: 27 ALLLVLLVDSLVAPHFWQVVLQDGRLFGSPIDILNRAAPVALLAIGMTLVIATGGIDLSV 86 ALL ++++ S ++ HFW +G+ + N+ + +LA+GMT V+ GGIDLSV Sbjct: 32 ALLAMIVLFSFLSSHFWS--------YGTFSTLANQIPDLMVLAVGMTFVLIIGGIDLSV 83 Query: 87 GAVMAIAGATTAAMTVAGFSLPIVLLSALGTGI--LAGLWNGILVAILKIQPFVATLILM 144 G+V+A+A A+T ++ + G+ ++ + LG + LAG G + +I F+ +L ++ Sbjct: 84 GSVLALA-ASTVSVAILGWGWGVLPSALLGMAVAALAGSITGGVTVAWRIPSFIVSLGVL 142 Query: 145 VAGRGVAQLITAGQIVTFNSPDLSWFGSGSLLFLPTPVIIAVLTLILFWLLTRKTALGMF 204 RG+A T + + +WF + + IIA+L ++L L+ +T G + Sbjct: 143 EMARGLAYQFTDSR-TAYIGDAYAWFSNPVAFGVSPAFIIALLVIVLAQLVLTRTVFGRY 201 Query: 205 IEAVGINIRAAKNAGVNTRIIVMLTYVLSGLCAAIAGIIVAADIRGADANNAGLWLELDA 264 + +G N A + AG++ R +L + L GL A +A + + + AD N AG LEL Sbjct: 202 LIGIGTNEEAVRLAGIDPRPYKVLVFALMGLLAGLAALFQISRLEAADPN-AGSGLELQV 260 Query: 265 ILAVVIGGGSLMGGRFNLLLSVVGALIIQGMNTGILLSGFPPEMNQVVKAVVVLCVLIVQ 324 I AVVIGG SLMGGR +++ + G LII + G+ G +++ V++ +++ Sbjct: 261 IAAVVIGGTSLMGGRGSVISTFFGVLIISVLAAGLAQIGASEPTKRIITGAVIVIAVVLD 320 Query: 325 SQR 327 + R Sbjct: 321 TYR 323 Lambda K H 0.327 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 331 Length adjustment: 28 Effective length of query: 313 Effective length of database: 303 Effective search space: 94839 Effective search space used: 94839 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory