Align 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 (characterized)
to candidate PP_3378 PP_3378 putative 2-ketogluconokinase
Query= SwissProt::P50845 (324 letters) >FitnessBrowser__Putida:PP_3378 Length = 316 Score = 301 bits (772), Expect = 1e-86 Identities = 161/309 (52%), Positives = 211/309 (68%), Gaps = 5/309 (1%) Query: 4 DAVTFGESMAMFYANEYGGLHEVSTFSKGLAGAESNVACGLARLGFRMGWMSKVGNDQLG 63 D + FGE+MAMF A + G L V F K +AGA+SNVA GLARLGF++ W+S+VG+D LG Sbjct: 5 DVLCFGETMAMFVAEQAGDLAGVGQFGKRIAGADSNVAIGLARLGFKVRWLSRVGDDSLG 64 Query: 64 TFILQELKKEGVDVSRVIRSQDEN-PTGLLLKSKVKEG-DPQVTYYRKNSAASTLTTAEY 121 F+L L+ EG+D S V D N PTG LK++ ++G DP V Y+R+ SAAS L+ A Sbjct: 65 RFVLDSLRCEGLDCSGV--EVDANYPTGFQLKARSEDGSDPAVEYFRRGSAASRLSAAMV 122 Query: 122 PRDYFQCAGHLHVTGIPPALSAEMKDFTYHVMNDMRNAGKTISFDPNVRPSLWPDQATMV 181 + Q A H+H TGIP ALS + ++ +++ MR AG++ISFDPN+RPSLWPDQ++MV Sbjct: 123 SPVWLQ-ARHVHATGIPLALSDSCRALSHALLDGMRAAGRSISFDPNLRPSLWPDQSSMV 181 Query: 182 HTINDLAGLADWFFPGIAEGELLTGEKTPEGIADYYLKKGASFVAIKLGKEGAYFKTGTS 241 IN LA ADW PG+ EG LLTG+ TP IA +YL +G V IKLG GAYF++ Sbjct: 182 REINALAAKADWVLPGLEEGRLLTGQHTPADIAAFYLDQGVELVVIKLGDAGAYFRSAKG 241 Query: 242 EGFLEGCRVDRVVDTVGAGDGFAVGVISGILDGLSYKDAVQRGNAIGALQVQAPGDMDGL 301 EG + V RVVDTVGAGD FAVGV+S +L+G +AV RGN G+ VQ+ GDM+GL Sbjct: 242 EGQVAPVPVSRVVDTVGAGDAFAVGVLSALLEGRPVAEAVARGNWCGSRAVQSRGDMEGL 301 Query: 302 PTREKLASF 310 P R +L ++ Sbjct: 302 PLRHELEAY 310 Lambda K H 0.317 0.135 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 316 Length adjustment: 28 Effective length of query: 296 Effective length of database: 288 Effective search space: 85248 Effective search space used: 85248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory