Align Altronate dehydratase; EC 4.2.1.7; D-altronate hydro-lyase (uncharacterized)
to candidate PP_3601 PP_3601 galactarate dehydratase
Query= curated2:O34673 (497 letters) >FitnessBrowser__Putida:PP_3601 Length = 517 Score = 244 bits (623), Expect = 5e-69 Identities = 164/495 (33%), Positives = 254/495 (51%), Gaps = 34/495 (6%) Query: 4 FIKIHKQDNVLLALRDIQKGERLHAYGVSIEVKDDIKRGHKIALQSIKENDSIVKYGFPI 63 ++++H DNV++ + D GE + + + + + + HK+A SI + + + +YG I Sbjct: 12 YVRLHDDDNVVVVVNDGGLGEGAR-FADGLTLIEGVPQSHKVATVSIAKGEPVRRYGQII 70 Query: 64 GHASQDISIGEHIHVHNTKTNLSDIQLYSYTPRFDENPYSN---ENRTFKGFRRENGDAG 120 G+A +D+ G V ++ + PR D P E TF+G+R +G G Sbjct: 71 GYALEDLRQGSW--VQESQLAMPAAPELDSLPRCDAVPQPLPPLEGFTFEGYRNADGTVG 128 Query: 121 VRNELWIVPTVGCVNGIAEKMLQRFVRETGDIAP-FDNVLVLKHQYGCSQLGDDHENTKQ 179 RN L I TV CV G+ E ++R E P D+V+ + H YGC + + Sbjct: 129 TRNILGITTTVQCVTGVLEHAVKRIRNELLPKYPNVDDVVAITHSYGCGVAINARDAYIP 188 Query: 180 I--LLNAIRHPNAGG-VLVLGLGCENNELARMKE--------------ALQDVNLKRVKF 222 I + N R+PN GG LV+ LGCE + +++ LQD +L V+ Sbjct: 189 IRTVRNLARNPNLGGEALVISLGCEKLQASQVMHDNDPSVDLSDPWLYRLQDASLGFVEM 248 Query: 223 LESQSVTDEMEAGVALLKEIHEAAKGDKREDIPLSELKIGLKCGGSDGFSGITANPLLGR 282 +E M+ LK++ + +RE +P SEL +G++CGGSD FSGITANP LG Sbjct: 249 IEQI-----MDLAETRLKKLDQR----RRETVPASELILGMQCGGSDAFSGITANPALGY 299 Query: 283 FSDYLIAQGGSTVLTEVPEMFGAETILMQRAANEEVFHKIVDLINDFKQYFIKHDQPVYE 342 +D L+ G + + +EV E+ A +L RA N++V +V ++ + +Y + Sbjct: 300 AADLLVRAGATVLFSEVTEVRDAIYMLTSRAENQDVADALVREMDWYDRYLQQGAADRSA 359 Query: 343 NPSPGNKAGGISTLEDKSLGCTQKAGISPVTDVLKYGEVLKTKGLTLLSAPGNDLIASSA 402 N +PGNK GG+S + +KSLG K+G + VL GE KGL + P +D + + Sbjct: 360 NTTPGNKKGGLSNIVEKSLGSIVKSGSGAIQGVLGPGERANRKGLIFCATPASDFVCGTL 419 Query: 403 LAAAGCQIVLFTTGRGTPFG-TFVPTVKVATNTELYEAKPHWIDFNAGLLAEDDVHEEYV 461 AAG + +FTTGRGTP+G P VKV T +EL + P ID +AG +A E + Sbjct: 420 QLAAGMNLHVFTTGRGTPYGLAMAPVVKVCTRSELAQRWPDLIDIDAGRIASGRSTIEEL 479 Query: 462 LREFIHYMIEVASGQ 476 E HY ++VASG+ Sbjct: 480 GWELFHYYLDVASGR 494 Lambda K H 0.317 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 564 Number of extensions: 25 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 517 Length adjustment: 34 Effective length of query: 463 Effective length of database: 483 Effective search space: 223629 Effective search space used: 223629 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory