GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gntT in Pseudomonas putida KT2440

Align gluconate:H+ symporter (gntT) (characterized)
to candidate PP_3417 PP_3417 D-gluconate transporter

Query= reanno::Cup4G11:RR42_RS28835
         (453 letters)



>lcl|FitnessBrowser__Putida:PP_3417 PP_3417 D-gluconate transporter
          Length = 450

 Score =  505 bits (1300), Expect = e-147
 Identities = 248/453 (54%), Positives = 335/453 (73%), Gaps = 6/453 (1%)

Query: 2   GAVTGTTLLLYALIAVIALVVLIAKFKLNPFITLVVVSVLLGFAVGMPMGDIVKSFEAGV 61
           G  T T LLL AL+ ++ L++LI  FK++PF+ L + +  LG   GMP+  ++KSF+ G 
Sbjct: 3   GLATDTFLLLDALVTIVGLILLITHFKVHPFVALTLAAGFLGLTSGMPVAKVMKSFQDGF 62

Query: 62  GGTLGHIALVVGLGTMLGKMMAESGGAERIARTLIDAFGEKNVHWAMVTIAFIVGLPVFF 121
           GG LG + +V+ LGTMLGK+MA+SGGA++IA+TLI AFG+KNVHWAM+  AF+VG+P+FF
Sbjct: 63  GGVLGFVGIVLALGTMLGKLMADSGGADQIAQTLIRAFGKKNVHWAMMFAAFLVGIPLFF 122

Query: 122 EVGFVLLVPIAFNVAKRTGTSMVLVGIPMVAGLSVVHGLIPPHPAALLAVTAYKADIGKT 181
           E+GFVLL+P+ F VA+R+G S+V +GIP++AGLSVVHGL+PPHP  LLA+  + ADIGKT
Sbjct: 123 EIGFVLLIPLVFIVARRSGVSLVKIGIPLLAGLSVVHGLVPPHPGPLLAIGIFHADIGKT 182

Query: 182 ILYALIVGIPTAAIAGPLFAKLMTRYVTLPDVNPLAAQFTEE-DEGVKASHELPGFGITL 240
           I Y LIV +PTA IAGPLF   ++RY+       L  Q  ++ D+G      LP F ITL
Sbjct: 183 IFYGLIVALPTAIIAGPLFGNFISRYIPGNPSQELMDQIAKDSDQG-----NLPSFSITL 237

Query: 241 FTILLPVILMLIGSWADLITTPKTFANDFLKLIGNSVIALLIAALVSFYTFGKRRGFTRE 300
            T+LLPV LML+ ++AD++   +     ++ LIG+ + ALL A L++FYTFG  RGF R+
Sbjct: 238 VTVLLPVALMLLKTFADVVLPAEHIVRQWMDLIGHPITALLAALLLAFYTFGSARGFNRQ 297

Query: 301 NILRFTNECVAPTAIITLVVGAGGGFGRVLRDSGISNAIVDVATGAHVSVLLLGWLVAVL 360
            I++  ++ +APTA I L+VGAGGGF ++L D+G+ N I  +A  A +S ++L WLVA +
Sbjct: 298 QIMKMLDQSLAPTAAIVLIVGAGGGFKQMLVDTGVGNVIGQMAVQAEISPIMLAWLVAAV 357

Query: 361 IRIATGSATVAMTTAAGIVAPIAASVPGTRPELLVLTTGAGSLILSHVNDGGFWLVKEYF 420
           IRIATGSATVA  T AGIVAP+   VPG   ELLVL TGAGSLILSHVND GFWLVK+YF
Sbjct: 358 IRIATGSATVATITGAGIVAPVIDLVPGVNRELLVLATGAGSLILSHVNDAGFWLVKQYF 417

Query: 421 NMTVAQTFKTWSVCETLISVIALLLTLALATVV 453
           NMTVA+TFKTWS+ ET++S++ ++  + L+ VV
Sbjct: 418 NMTVAETFKTWSMMETILSIVGIIFIMLLSLVV 450


Lambda     K      H
   0.326    0.141    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 760
Number of extensions: 43
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 453
Length of database: 450
Length adjustment: 33
Effective length of query: 420
Effective length of database: 417
Effective search space:   175140
Effective search space used:   175140
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory