Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate PP_0225 PP_0225 sulfur compound ABC transporter - ATP-binding subunit
Query= reanno::pseudo6_N2E2:Pf6N2E2_2050 (263 letters) >FitnessBrowser__Putida:PP_0225 Length = 252 Score = 241 bits (614), Expect = 1e-68 Identities = 127/248 (51%), Positives = 171/248 (68%), Gaps = 6/248 (2%) Query: 13 LLDIRGLRKQYGPLEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQIML 72 +++++GL K++ VL G+DL++Q G VV +IG SGSGKTT LRC+N+LE GQI Sbjct: 1 MIEVKGLTKRFKGQTVLNGIDLTVQPGEVVAIIGPSGSGKTTFLRCLNLLETPDAGQIQ- 59 Query: 73 DGESIGYDDIDGKR-VRHPEKVIARHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLP 131 IG ID R + + I R R G FQ FNLFPH TAL+NV G + VKK P Sbjct: 60 ----IGAISIDANRPLGGQQSAIRRLRQQAGFVFQNFNLFPHRTALENVIEGPVIVKKTP 115 Query: 132 KDEAVALAEKWLERVGLLERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDP 191 +++A+ L + L +VGL + D +P +LSGGQQQRVAIARA+AM P ++LFDE TSALDP Sbjct: 116 REQAIELGRRLLAKVGLAGKEDAYPRRLSGGQQQRVAIARALAMEPEVILFDEPTSALDP 175 Query: 192 ELVGEVLNVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERPQS 251 ELVGEVL I+GLAE+ TM++VTHEM FA +V+++++F ++G I EQG K LF P+ Sbjct: 176 ELVGEVLATIRGLAEEKRTMIIVTHEMSFARDVANRVIFFDKGVIVEQGEAKALFAAPKE 235 Query: 252 PRLAEFLK 259 R +FL+ Sbjct: 236 ERTRQFLR 243 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 252 Length adjustment: 24 Effective length of query: 239 Effective length of database: 228 Effective search space: 54492 Effective search space used: 54492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory