Align 2-dehydro-3-deoxy-D-gluconate-6-phosphate aldolase (EC 4.1.2.55) (characterized)
to candidate PP_1024 PP_1024 KHG/KDPG aldolase
Query= metacyc::MONOMER-15645 (213 letters) >FitnessBrowser__Putida:PP_1024 Length = 235 Score = 207 bits (526), Expect = 2e-58 Identities = 96/193 (49%), Positives = 143/193 (74%) Query: 17 VVPVIVINKLEHAVPMAKALVAGGVRVLELTLRTECAVEAIRLIAQEVPDAIVGAGTVTN 76 ++PVI I + E +P+A AL AGG+R LE+TLR++ ++AI+++ ++ P+ VGAGTV + Sbjct: 38 ILPVITIAREEDILPLADALAAGGIRTLEVTLRSQHGLKAIQVLREQRPELCVGAGTVLD 97 Query: 77 PQQLAEVTAAGAQFAISPGLTEPLLKAATEGTIPLIPGISTVSELMLGMDYGLREFKFFP 136 A V AAGAQF ++PG+T+ +L+A + IPL+PGIST SE+M+G G R FK FP Sbjct: 98 RSMFAAVEAAGAQFVVTPGITQDILEAGVDSEIPLLPGISTPSEIMMGYALGYRRFKLFP 157 Query: 137 AEANGGVKALQAIAGPFGKIRFCPTGGISLKNYRDYLALKSVLCVGGSWLVPADALESGD 196 AE +GGV A++A GPFG IRFCPTGG++ N R+Y+AL +V+CVGG+W++ + +++GD Sbjct: 158 AEISGGVAAIKAFGGPFGDIRFCPTGGVNPANVRNYMALPNVMCVGGTWMLDSSWIKNGD 217 Query: 197 YDRITALAREAVA 209 + RI A + EA+A Sbjct: 218 WARIEACSAEAMA 230 Lambda K H 0.318 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 235 Length adjustment: 22 Effective length of query: 191 Effective length of database: 213 Effective search space: 40683 Effective search space used: 40683 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory