Align D-gluconate dehydrogenase cytochrome c subunit (EC 1.1.99.3) (characterized)
to candidate PP_4232 PP_4232 Cytochrome c family protein
Query= metacyc::MONOMER-12746 (434 letters) >FitnessBrowser__Putida:PP_4232 Length = 403 Score = 275 bits (703), Expect = 2e-78 Identities = 167/418 (39%), Positives = 230/418 (55%), Gaps = 24/418 (5%) Query: 7 ATLALLGSAAANAAEADQQALVQQGEYLARAGDCVACHTAKDGKPFAGGLPMETPIGVIY 66 A+ LG A ++ A A A V++GEYLARA DC+ACHTA+ G P+AGGLP+ +P G IY Sbjct: 7 ASALALGLAVSSFALAADDAQVKRGEYLARAADCMACHTAEGGAPYAGGLPIHSPFGTIY 66 Query: 67 STNITPDKT-GIGDYSFEDFDKAVRHGVAKGGSTLYPAMPFPSYARVSDADMQALYAYFM 125 +NITPDK GIG+YS ++F AV G K G+ LYPAMP+ SY + D A+ AY M Sbjct: 67 GSNITPDKQYGIGNYSADEFFAAVTEGKRKDGANLYPAMPYTSYHLIKREDSDAILAYLM 126 Query: 126 KGVAPVARDNQDSDIPWPLSMRWPLSIWRWMFAPSVETPAPAAGSDPVISRGAYLVEGLG 185 + P+ R + + +P ++R LS W ++ SV+ P G P RG Y+VE LG Sbjct: 127 T-IPPINRPAPQTALRFPFNVRMGLSGWNMLYGKSVQL-QPTEGKSPAWQRGQYMVEVLG 184 Query: 186 HCGACHTPRALTMQEKALSASGGSDFLSGSAPLEGWIAKSLRGDHKDGLGSWSEEQLVQF 245 HCG CHTPR + A LSG L G++A SL G W++ L F Sbjct: 185 HCGECHTPR------NPIGALQQDQRLSGGL-LGGYLAPSLLAQDLAERG-WTQPDLTTF 236 Query: 246 LKTGRSDRSAVFGGMSDVVVHSMQYMTDADLTAIARYLKSLPANDPKDQPHQYDKQVAQA 305 LK G S + ++F M VV HS Q++ DADL A+A YL DQP + A Sbjct: 237 LKHGISAQGSMFNEMFPVVHHSTQHLEDADLAAMATYLLG-------DQPPPAKAIESVA 289 Query: 306 LWN-GDDSKPGAAVYIDNCAACHRTDGHGYTRVFPALAGNPVLQSADATSLIHIVLKGGT 364 L D +K G Y++ CA CH DG G + A+ GN VL+ AD+ +L+ +VL+G Sbjct: 290 LEQMSDSAKRGHQQYLNVCAGCHGVDGEGKPHIAVAMRGNTVLRQADSRNLVKVVLEGIR 349 Query: 365 LPATHSAPSTFTMPAFAWRLSDQEVADVVNFIRSSWGNQASAVKPGDVAALRNGDLQS 422 MP FA +L DQ+V D+VN++R +WG PGD+ + +L++ Sbjct: 350 EQQFTGFERMQPMPGFADKLDDQQVIDMVNYLRQAWGG-----LPGDLNVQQLAELKA 402 Lambda K H 0.316 0.131 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 489 Number of extensions: 29 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 403 Length adjustment: 32 Effective length of query: 402 Effective length of database: 371 Effective search space: 149142 Effective search space used: 149142 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory