Align gluconolactonase (EC 3.1.1.17) (characterized)
to candidate PP_1170 PP_1170 Gluconolactonase
Query= BRENDA::Q64374 (299 letters) >FitnessBrowser__Putida:PP_1170 Length = 293 Score = 124 bits (311), Expect = 3e-33 Identities = 92/288 (31%), Positives = 136/288 (47%), Gaps = 13/288 (4%) Query: 17 GESPVWEEASQSLLFVDIPSKIICRWDTVSNQVQRVAVDAPVSSVALRQLGGYVATIGTK 76 GESPVW Q+L +VDIP++ + RW + Q D ++ +A R G+VA + + Sbjct: 14 GESPVWHPGEQALYWVDIPARQLHRWQAADGKHQCWQGDEMLACIA-RSGQGWVAGMESG 72 Query: 77 FCALNWENQSVF---VLAMVDEDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGS 133 L + +L+ V + RFNDG+ D GR++AGTM + H G+ Sbjct: 73 IFQLQAKADGSLDSRLLSNVQHAQAGMRFNDGRCDRQGRFWAGTMLLDMQQGA---HVGA 129 Query: 134 LYSLFPDHSVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYT--VDAFDYDLQTGQISNRR 191 LY + + D + + NGL +S D K Y DS V AFDYD +G + Sbjct: 130 LYRHDGEGHLHLQQDGMIVPNGLAFSPDGKRMYLSDSHPNVQKVWAFDYDTDSGTPHGKH 189 Query: 192 IVYKMEKDEQIPDGMCIDAEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFG 251 + M PDG ID +G W+ + G++ R PE G+ +++ +PV K C FG Sbjct: 190 LFVDMRNYPGRPDGAAIDQDGCYWICGNDAGQIHRFTPE-GRLDRSLSVPVKKPAMCAFG 248 Query: 252 GKDYSEMYVTCARDGLNAEGLLRQPDAGNIFKITGLGVKGIAPYSYAG 299 G +YVT R L QP AG +F + G KG+ +Y G Sbjct: 249 GASLDILYVTSIRP--TGIDLSDQPLAGGVFALDP-GTKGLEEPAYRG 293 Lambda K H 0.319 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 293 Length adjustment: 26 Effective length of query: 273 Effective length of database: 267 Effective search space: 72891 Effective search space used: 72891 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory