Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate PP_2748 PP_2748 putative Branched-chain amino acid ABC transporter, ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >FitnessBrowser__Putida:PP_2748 Length = 266 Score = 187 bits (474), Expect = 3e-52 Identities = 107/271 (39%), Positives = 157/271 (57%), Gaps = 9/271 (3%) Query: 1 MMSPVTNTMSDDTLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCI 60 M + ++ LL+V ++S+ F G+ AI+D SF +RG+I ALIGPNGAGK+++ N + Sbjct: 1 MAARISGARGMSALLEVRNVSLSFKGVKAISDLSFSVRRGEICALIGPNGAGKSSLLNIL 60 Query: 61 TGFYKPTMGMITFNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQ 120 G Y+ G + F + R P + RTFQN LF ++VL+NLL Sbjct: 61 NGVYRADAGQLFFATEP------LRRPHPLQAARLGIGRTFQNNALFKKMSVLDNLLTGL 114 Query: 121 HNKLMKASGYTILGLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRL 180 ++ ++ Y + +G+ +REA E A L +L D G L YG Q+R+ Sbjct: 115 -SRFQRS--YFLEQALGLPRARREARAFAERAEQVLAFLELQPWRDVAVGSLAYGLQKRV 171 Query: 181 EIARAMCTGPELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISD 240 E+ RA+ P LL LDEP AG+N E ++ + I + GT+++LIEHD+ VVM +S Sbjct: 172 ELGRALIAQPTLLLLDEPMAGMNAEEKQDMSRFIADINRDLGTTVILIEHDIQVVMGLSS 231 Query: 241 HVVVLEYGQKISDGTPDHVKNDPRVIAAYLG 271 HVVVL+YG+K+ DGTP V+ +P VIAAYLG Sbjct: 232 HVVVLDYGRKVGDGTPAEVQANPDVIAAYLG 262 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 266 Length adjustment: 26 Effective length of query: 266 Effective length of database: 240 Effective search space: 63840 Effective search space used: 63840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory