Align glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized)
to candidate PP_1070 PP_1070 glutamate / aspartate ABC transporter - permease subunit
Query= CharProtDB::CH_011913 (426 letters) >FitnessBrowser__Putida:PP_1070 Length = 248 Score = 90.1 bits (222), Expect = 6e-23 Identities = 70/223 (31%), Positives = 111/223 (49%), Gaps = 16/223 (7%) Query: 204 VVDLGWNLPVSLNALAILAVMSASFWGWRRFMARAKAVQEATGTRPTTWWPSLLILFAPI 263 + LGW + +++ A I+A++ S G R + AT + + LF + Sbjct: 26 ITGLGWTIAIAITAW-IIALLLGSLLGVMRTVPNRLVSGIAT---------AYVELFRNV 75 Query: 264 SALLYGLGFHLDYPQITKFDFTGGF-QMLHSFTALLIA----LTLYTAAFIAEIVRAGIQ 318 L+ ++ P + F Q L+ T+ LI+ L L+TAA + E VR GIQ Sbjct: 76 PLLVQLFIWYFLVPDLLPEGLQEWFKQDLNPTTSALISVVICLGLFTAARVCEQVRTGIQ 135 Query: 319 AISRGQTEAAYALGLRPGRTMSLVILPQALRVIVPPLISQFLNLTKNSSLAIAVSYMDLR 378 A+ +GQ AA A+G + + V+LPQA R+I+PPL S+FLN+ KNSS+A + M+L Sbjct: 136 ALPKGQEAAARAMGFSLPQIYNNVLLPQAYRIIIPPLTSEFLNVFKNSSVASLIGLMELL 195 Query: 379 GTLGGITLNQTGRELECMLLMMLIYLTISLTISSLMNLYNKSI 421 T + E L LIY T+++ + LM + K + Sbjct: 196 AQTKQ-TAEFSANLFEAFTLATLIYFTLNMGLMLLMRMVEKKV 237 Score = 56.2 bits (134), Expect = 1e-12 Identities = 30/76 (39%), Positives = 47/76 (61%), Gaps = 4/76 (5%) Query: 82 DTHFRALIEGLLNTLLVSVLGCILATILGTIIGVLRLSQNWLVARIMTVYVETFRNIPLL 141 +T+ I GL T+ +++ I+A +LG+++GV+R N LV+ I T YVE FRN+PLL Sbjct: 19 ETYLDWYITGLGWTIAIAITAWIIALLLGSLLGVMRTVPNRLVSGIATAYVELFRNVPLL 78 Query: 142 ----LWILLMGTILAE 153 +W L+ +L E Sbjct: 79 VQLFIWYFLVPDLLPE 94 Lambda K H 0.326 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 426 Length of database: 248 Length adjustment: 28 Effective length of query: 398 Effective length of database: 220 Effective search space: 87560 Effective search space used: 87560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory