GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gdhA in Pseudomonas putida KT2440

Align glutamate dehydrogenase (EC 1.4.1.2) (characterized)
to candidate PP_0675 PP_0675 glutamate dehydrogenase, NADP-dependent

Query= BRENDA::Q9TVN3
         (438 letters)



>lcl|FitnessBrowser__Putida:PP_0675 PP_0675 glutamate dehydrogenase,
           NADP-dependent
          Length = 449

 Score =  505 bits (1300), Expect = e-147
 Identities = 249/434 (57%), Positives = 323/434 (74%), Gaps = 1/434 (0%)

Query: 4   LEARNPAQPEFIQASREVIESIIDVVNSNPKYLENKILERITEPNLIHEFKVEWENDKHE 63
           L+ R+P QPEF QA  EV+ ++   + +NP YL++ ILER+ EP     F+V W +D+ +
Sbjct: 15  LKQRDPGQPEFHQAVEEVLRTLWPFLEANPHYLQSGILERMVEPERAVLFRVSWVDDQGK 74

Query: 64  IMVNKGYRIQFNNAIGPYKGGLRFHRAVTLGTLKFLGFEQIFKNSLTGLPMGGGKGGSDF 123
           + VN+GYRIQ ++AIGPYKGGLRFH +V L  LKFL FEQ+FKNSLT LPMGGGKGGSDF
Sbjct: 75  VQVNRGYRIQMSSAIGPYKGGLRFHPSVNLSVLKFLAFEQVFKNSLTSLPMGGGKGGSDF 134

Query: 124 DPRGKSDAEILRFCRSFMTSLFKYIGPEIDVPAGDIGVGGREIGYLFGQYKRLTQQHEGV 183
           DP+GKSDAE++RFC++FM+ L+++IG + DVPAGDIGVG REIG++FGQYKRL  Q   V
Sbjct: 135 DPKGKSDAEVMRFCQAFMSELYRHIGADCDVPAGDIGVGAREIGFMFGQYKRLANQFTSV 194

Query: 184 LTGKGLNWGGSLVRPEATGFGTMYFANEVLHAHGDDIKGKTIAISGFGNVAFGAVLKAKQ 243
           LTGKG+ +GGSL+RPEATG+G +YFA E+L      I G+ +A+SG GNVA  A  K   
Sbjct: 195 LTGKGMTYGGSLIRPEATGYGCVYFAEEMLKRQDKRIDGRRVAVSGSGNVAQYAARKVMD 254

Query: 244 LGAKVVTISGPDGYIYDENGINTDEKINYMLELRASNNDVVAPFAEKFGAKFIPGKKPWE 303
           LG KV+++S  +G +Y E G+ TD + + ++EL+      ++  A +FG +F  G+ PW 
Sbjct: 255 LGGKVISLSDSEGTLYAEAGL-TDAQWDALMELKNVKRGRISELAGQFGLEFRKGQTPWS 313

Query: 304 VPVDMAFPCAIQNELNAEDAATLHKNGVKYVIETSNMGCTADAVQYFIKNRIVFAPGKAA 363
           +P D+A PCA QNEL AEDA TL +NG   V E +NM  T +AV  F+   I++APGKA+
Sbjct: 314 LPCDIALPCATQNELGAEDARTLLRNGCICVAEGANMPTTLEAVDIFLDAGILYAPGKAS 373

Query: 364 NAGGVAVSGLEMSQNSMKLNWTAEEVDAKLKNIMTNIHASCVKEGKESDGYINYVKGANI 423
           NAGGVAVSGLEMSQN+M+L WTA EVD+KL NIM +IH +CV  G+E+DG INYVKGANI
Sbjct: 374 NAGGVAVSGLEMSQNAMRLLWTAGEVDSKLHNIMQSIHHACVHYGEEADGRINYVKGANI 433

Query: 424 AGFKKVADAMVDLG 437
           AGF KVADAM+  G
Sbjct: 434 AGFVKVADAMLAQG 447


Lambda     K      H
   0.317    0.137    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 560
Number of extensions: 19
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 438
Length of database: 449
Length adjustment: 32
Effective length of query: 406
Effective length of database: 417
Effective search space:   169302
Effective search space used:   169302
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory