GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gltP in Pseudomonas putida KT2440

Align Proton/glutamate-aspartate symporter; Glutamate-aspartate carrier protein; Proton-glutamate-aspartate transport protein (characterized)
to candidate PP_0137 PP_0137 glutamate/aspartate-proton DAACS transporter

Query= SwissProt::P21345
         (437 letters)



>lcl|FitnessBrowser__Putida:PP_0137 PP_0137
           glutamate/aspartate-proton DAACS transporter
          Length = 442

 Score =  607 bits (1565), Expect = e-178
 Identities = 313/430 (72%), Positives = 368/430 (85%), Gaps = 1/430 (0%)

Query: 1   MKNIKFSLAWQILFAMVLGILLGSYLHYHSDSRDWLVVNLLSPAGDIFIHLIKMIVVPIV 60
           MK  K SLAWQI+  +VLG+ +G+ L++ S  + W + N+L PAGDIFI LIKMIVVPIV
Sbjct: 1   MKKAKLSLAWQIVIGLVLGVAIGALLNHFSAEKAWWISNVLQPAGDIFIRLIKMIVVPIV 60

Query: 61  ISTLVVGIAGVGDAKQLGRIGAKTIIYFEVITTVAIILGITLANVFQPGAGVDMSQLATV 120
           IS+L+VGIAGVGDAK+LG IG KTIIYFEV+TT+AI++G+ LAN+F PGAG+DMS L TV
Sbjct: 61  ISSLIVGIAGVGDAKKLGSIGLKTIIYFEVVTTIAIVVGLVLANLFHPGAGIDMSTLGTV 120

Query: 121 DISKYQSTTEAVQSSSHGIMGTILSLVPTNIVASMAKGEMLPIIFFSVLFGLGLSSLPAT 180
           DISKYQ+T   VQ   H  + T+L+L+P+NI A++ +GEMLPIIFFSV+FGLGLSSL A 
Sbjct: 121 DISKYQATAAEVQHE-HAFIETLLNLIPSNIFAALMRGEMLPIIFFSVMFGLGLSSLQAE 179

Query: 181 HREPLVTVFRSISETMFKVTHMVMRYAPVGVFALIAVTVANFGFSSLWPLAKLVLLVHFA 240
            R+PLV  F+++SETMFKVTHM+M YAP+GVFALIAVTVANFGFSSL PLAKLV+LV+FA
Sbjct: 180 LRDPLVRTFQAVSETMFKVTHMIMNYAPIGVFALIAVTVANFGFSSLLPLAKLVVLVYFA 239

Query: 241 ILFFALVVLGIVARLCGLSVWILIRILKDELILAYSTASSESVLPRIIEKMEAYGAPVSI 300
           I FFA +VLG+VARL G SV  ++RI+KDELILAYST+SSE+VLPR+IEKME YGAP SI
Sbjct: 240 IAFFAFMVLGLVARLFGFSVIKIMRIMKDELILAYSTSSSETVLPRVIEKMEKYGAPKSI 299

Query: 301 TSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSIWQEIILVLTLMVTSKGIAGVPGV 360
            SFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLS  Q+++LVLTLMVTSKGIAGVPGV
Sbjct: 300 CSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSWSQQLLLVLTLMVTSKGIAGVPGV 359

Query: 361 SFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWEHKFDRKKA 420
           SFVVLLATLGSVGIPLEGLAFIAGVDRI+DMARTALNVVGNALA LVIA+WE  +D  K 
Sbjct: 360 SFVVLLATLGSVGIPLEGLAFIAGVDRIMDMARTALNVVGNALAALVIARWEGMYDAVKG 419

Query: 421 LAYEREVLGK 430
             Y   ++ +
Sbjct: 420 EQYYASLMAE 429


Lambda     K      H
   0.326    0.141    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 649
Number of extensions: 20
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 437
Length of database: 442
Length adjustment: 32
Effective length of query: 405
Effective length of database: 410
Effective search space:   166050
Effective search space used:   166050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory