Align GluD aka CGL1953, component of Glutamate porter (characterized)
to candidate PP_5023 PP_5023 Amino acid ABC transporter, permease protein
Query= TCDB::P48245 (273 letters) >FitnessBrowser__Putida:PP_5023 Length = 320 Score = 114 bits (286), Expect = 2e-30 Identities = 71/200 (35%), Positives = 115/200 (57%), Gaps = 4/200 (2%) Query: 29 GLWGTLKSAVFSVILALVMGTALGLGRISEIRILRWFCAVIIETFRAIPVLILMIFAYQM 88 GLW TL +V S L LV+G GL R+S LR V +E R P+L+ IF + Sbjct: 121 GLWTTLWISVVSGALGLVIGLFAGLCRLSNNPTLRDLSTVYVELVRGTPLLV-QIFIFYF 179 Query: 89 FAQYNIVPSSQLAFAAVVFGLTMYNGSVIAEILRSGIASLPKGQKEAAIALGMSSRQTTW 148 F + S + A A L ++ G+ +AEI+R+G+ S+ KGQ EAA +LG+++ Q+ Sbjct: 180 FIGTVLNLSREFAGVAA---LALFTGAYVAEIVRAGVQSIAKGQNEAARSLGLNAGQSMR 236 Query: 149 SILLPQAVAAMLPALISQMVIALKDSALGYQIGYIEVVRSGIQSASVNRNYLAALFVVAL 208 ++LPQA +LP L Q + +KD++L I E+ +SG ++ + + + F VA Sbjct: 237 HVILPQAFKRVLPPLAGQFISLVKDTSLVSVIAITELTKSGREAITTSFSTFEIWFCVAG 296 Query: 209 IMIVLNFSLTALASRIERQL 228 + +++N L+ +ASR+ER+L Sbjct: 297 LYLLINLPLSHIASRLERRL 316 Lambda K H 0.323 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 320 Length adjustment: 26 Effective length of query: 247 Effective length of database: 294 Effective search space: 72618 Effective search space used: 72618 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory