Align Tonoplast intrinsic protein-a (transports water, urea, glycerol and gases (CO2 and NH3) (characterized)
to candidate PP_4282 PP_4282 Aquaporin Z
Query= TCDB::Q9XG70 (247 letters) >FitnessBrowser__Putida:PP_4282 Length = 230 Score = 96.3 bits (238), Expect = 5e-25 Identities = 71/217 (32%), Positives = 100/217 (46%), Gaps = 20/217 (9%) Query: 24 EFICTFLFVFAGVGSAMAANKLNGDPL-VSLFFVAMAHALVVAVTISAGFRISGGHLNPA 82 E I TF V G GSA+ A PL + + VA A L V A ISG HLNPA Sbjct: 10 ELIGTFWLVLGGCGSAVLAAS---SPLGIGVLGVAFAFGLTVLTMAFAIGHISGCHLNPA 66 Query: 83 VTLGLCMGGHITVFRSILYWIDQLLASVAACALLNYLT---AGLETPVHTLAN------- 132 V+ GL +GG + Y I Q++ ++ A ++ + AG E +N Sbjct: 67 VSFGLVVGGRFPAKELLPYVIAQVIGAILAAGVIYLIASGKAGFELSAGLASNGYADHSP 126 Query: 133 -GVSYGQGIIMEVILTFSLLFTVYTTIVDPKKGILEGMGPLLTGLVVGANIMAGGPFSGA 191 G + G G + EV++T ++ V D + G P+ GL + + P + Sbjct: 127 GGYTLGAGFVSEVVMT-AMFLVVIMGATDARAP--AGFAPIAIGLALTLIHLISIPVTNT 183 Query: 192 SMNPARSFGPAFVSGIWT--DHWVYWVGPLIGGGLAG 226 S+NPARS GPA G W W++WV PLIG + G Sbjct: 184 SVNPARSTGPALFVGGWALQQLWLFWVAPLIGAAIGG 220 Lambda K H 0.327 0.142 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 230 Length adjustment: 23 Effective length of query: 224 Effective length of database: 207 Effective search space: 46368 Effective search space used: 46368 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory