Align ABC transporter for Glycerol, ATPase component 1 (characterized)
to candidate PP_2260 PP_2260 putative glycerol-phosphate ABC transporter, ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_791 (363 letters) >FitnessBrowser__Putida:PP_2260 Length = 364 Score = 330 bits (847), Expect = 3e-95 Identities = 187/362 (51%), Positives = 238/362 (65%), Gaps = 15/362 (4%) Query: 1 MQLALDSISKKVGAQTWLYDMSLALQSGAVTVLLGATQAGKTSLMRIMAGLDAPTAGRVT 60 M L L+ +S+ V Q W+ D SL + G+ VLLG T AGKTSLMR+MAGLD P GRV Sbjct: 1 MSLVLEQVSRSVDNQPWIVDASLRFEPGSFNVLLGRTLAGKTSLMRLMAGLDRPDRGRVL 60 Query: 61 VDGKDVTGMPVRDRNVAMVYQQFINYPSMKVAANIASPLKLR--GEKNIDARVREIASRL 118 +DG+DVTG+PVR RNV+MVYQQFINYP++ V NIASPL+ E I RV+E A L Sbjct: 61 MDGQDVTGVPVRQRNVSMVYQQFINYPTLSVYENIASPLRQARMAEDQIRRRVQETAEML 120 Query: 119 HIDMFLDRYPAELSGGQQQRVALARALAKGAPLMLLDEPLVNLDYKLREELREELTQLFA 178 I+ +L R P ELSGGQQQR A+ARAL K A L+L DEPLVNLDYKLRE LR+EL +LFA Sbjct: 121 RIETYLQRLPLELSGGQQQRTAMARALVKDASLILFDEPLVNLDYKLREGLRQELRELFA 180 Query: 179 AGQSTVVYATTEPGEALLLGGYTAVLDEGQLLQYGPTAEVFHAPNSLRVARAFSDPPMNL 238 A VYATTEP EAL LGG T ++ EG+++Q GPTAEV+ P+S+ A FS+PP+NL Sbjct: 181 ARHCIAVYATTEPNEALALGGTTTLVHEGRIVQSGPTAEVYQRPSSVLAAELFSEPPINL 240 Query: 239 MAASAT------AQGVRLQGGAELTLPLPQGAATAAGLTVGVRASALR-VHARPGDVSVA 291 ++ T AQ V A+L PL +G GVR S + V A D+ +A Sbjct: 241 VSGRITGNEVSLAQTVHFARNADLE-PLAEG-----DYRFGVRPSHIALVPAHDDDLELA 294 Query: 292 GVVELAEISGSDTFVHASTPWGDLVAQLTGVHYFELGTAITLHLDPAQAYVFGADGRLAQ 351 +VELAEISGS+TF+H + +V L GVH +++ T I + + + +VF + G L Q Sbjct: 295 VLVELAEISGSETFLHVRNEYWRMVLHLPGVHEYQVDTPIRVFIPTHKLFVFDSAGLLVQ 354 Query: 352 AP 353 AP Sbjct: 355 AP 356 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 364 Length adjustment: 29 Effective length of query: 334 Effective length of database: 335 Effective search space: 111890 Effective search space used: 111890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory