Align GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate PP_2261 PP_2261 Sugar ABC transporter, ATP-binding protein
Query= TCDB::G3LHY8 (358 letters) >FitnessBrowser__Putida:PP_2261 Length = 365 Score = 155 bits (392), Expect = 2e-42 Identities = 99/307 (32%), Positives = 161/307 (52%), Gaps = 5/307 (1%) Query: 13 ADYHIYPTDLVLERGTLNVLLGPTLAGKTSLMRLMAGLDRPTGGSIHFDGTDVTGMPVQK 72 ADY ++ + V E+G LLGP+ GK++L+ +++GL P+ G + FDG V + Q Sbjct: 21 ADYALHALEHVWEQGGAYALLGPSGCGKSTLLNIISGLLTPSHGEVLFDGKPVNQLSPQA 80 Query: 73 RNVAMVYQQFINYPALTVYNNIASPMRISGKDAATIDREVRKAAELLKLTPYLDRTPLNL 132 RN+A V+Q + Y +TV++N+A P+R G D A + V + AE+L+LT L + NL Sbjct: 81 RNIAQVFQFPVVYDTMTVFDNLAFPLRNQGLDEARVRARVEEIAEVLELTAVLRKKARNL 140 Query: 133 SGGQQQRTALARALVK-NASLVLMDEPLANLDYKLREELREELPKIFAQSGAIFVYATTE 191 + ++Q+ ++ R LV+ + S +L DEPL +D L+ +LR +L +I Q +Y T + Sbjct: 141 TADEKQKVSMGRGLVRDDVSAILFDEPLTVIDPHLKWKLRRKLKQIHEQFNITMIYVTHD 200 Query: 192 PSEALLLGGNTATLNQGRVTQFGPTIEVYRRPVNLATAGIFADPPLNTLDV-TKSGNVFT 250 EA A ++ GR+ QFG E++ RP + P +N +DV ++G V Sbjct: 201 QLEASTFADKIAVMHGGRIVQFGTPRELFERPRHTFVGYFIGSPGMNLIDVRAEAGAVVF 260 Query: 251 RPSGVTIP--VPSHLAVVPDGPVTIAFHPHHLGLAPQTGDAARLQARTLVSEITGSESFV 308 + +P + LA + G + + P + L + A AR L E G+ V Sbjct: 261 GDVQLVLPDGLCERLASLAGGRLQVGIRPEFVQLWDSPFEGA-YPARVLDVEDLGTYRIV 319 Query: 309 HLEYDGV 315 LE GV Sbjct: 320 TLELGGV 326 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 365 Length adjustment: 29 Effective length of query: 329 Effective length of database: 336 Effective search space: 110544 Effective search space used: 110544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory