Align ABC transporter for Glycerol, ATPase component 2 (characterized)
to candidate PP_0411 PP_0411 Polyamine ABC transporter, ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_792 (358 letters) >FitnessBrowser__Putida:PP_0411 Length = 374 Score = 163 bits (412), Expect = 8e-45 Identities = 100/280 (35%), Positives = 149/280 (53%), Gaps = 32/280 (11%) Query: 27 LKMEFEDGGAYALLGPSGCGKTTMLNIMSGLLVPSHGKVLFDGRDVTRASPQERNIAQVF 86 L ++ G LLGPSG GKTT L +++G P+ G++ GR + P +R+I VF Sbjct: 34 LNLDIRKGEFLTLLGPSGSGKTTSLMMLAGFETPTAGEIQLGGRSINNVPPHKRDIGMVF 93 Query: 87 QFPVIYDTMTVAENLAFPLRNRKVPEGQIKQRVGVIAEMLEMSGQLNQRAAGLAADAKQK 146 Q ++ MTVAENLAFPL R + + I +RV + M+++ + L+ +Q+ Sbjct: 94 QNYALFPHMTVAENLAFPLTVRNLSKTDISERVKRVLNMVQLDAFAKRYPGQLSGGQQQR 153 Query: 147 ISLGRGLVRADVAAVLFDEPLTVIDPHLKWQLRRKLKQIHHELKLTLIYVTHDQVEALTF 206 ++L R LV + VL DEPL +D L+ ++ ++K IH L +T++YVTHDQ EALT Sbjct: 154 VALARALV-FEPQLVLMDEPLGALDKQLREHMQMEIKHIHQRLGVTVVYVTHDQGEALTM 212 Query: 207 ADQVVVMTRGKAVQVGSADALFERPAHTFVGHFIGSPGMNFLPAHRDGENLSVAGHRLAS 266 +D+V V +G+ Q+ L+E P +TFV +FI GEN ++G LAS Sbjct: 213 SDRVAVFHQGEIQQIADPRTLYEEPCNTFVANFI-------------GENNRISGTLLAS 259 Query: 267 ---------PVGRALPAGALQVG---------IRPEYLAL 288 P G + A A+ VG IRPE + L Sbjct: 260 DGKRCQVQLPRGERVEALAVNVGQAGEPVTLSIRPERVRL 299 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 374 Length adjustment: 30 Effective length of query: 328 Effective length of database: 344 Effective search space: 112832 Effective search space used: 112832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory