Align ABC transporter for Glycerol, ATPase component 2 (characterized)
to candidate PP_1018 PP_1018 mannose/glucose ABC transporter - ATP binding subunit
Query= reanno::acidovorax_3H11:Ac3H11_792 (358 letters) >FitnessBrowser__Putida:PP_1018 Length = 384 Score = 203 bits (517), Expect = 5e-57 Identities = 122/330 (36%), Positives = 190/330 (57%), Gaps = 13/330 (3%) Query: 24 LLPLKMEFEDGGAYALLGPSGCGKTTMLNIMSGLLVPSHGKVLFDGRDVTRASPQERNIA 83 L +++ +DG L+GPSGCGK+T++N ++GL + G +L D +DV+ SP++R+IA Sbjct: 21 LKDIQLSIKDGEFLILVGPSGCGKSTLMNCIAGLEQITGGAILIDEQDVSGMSPKDRDIA 80 Query: 84 QVFQFPVIYDTMTVAENLAFPLRNRKVPEGQIKQRVGVIAEMLEMSGQLNQRAAGLAADA 143 VFQ +Y TM+V EN+ F L+ RK+P+ I + V +A++L++ L ++ A L+ Sbjct: 81 MVFQSYALYPTMSVRENIEFGLKIRKLPQAAIDEEVARVAKLLQIEHLLARKPAQLSGGQ 140 Query: 144 KQKISLGRGLVRADVAAVLFDEPLTVIDPHLKWQLRRKLKQIHHELKLTLIYVTHDQVEA 203 +Q++++GR L R LFDEPL+ +D L+ ++R ++K +H LK T +YVTHDQ+EA Sbjct: 141 QQRVAMGRALARRP-KIYLFDEPLSNLDAKLRVEMRTEMKLMHQRLKTTTVYVTHDQIEA 199 Query: 204 LTFADQVVVMTRGKAVQVGSADALFERPAHTFVGHFIGSPGMNFLP---AHRDGENLSVA 260 +T D+V VM G Q G+ ++ PA+ FV FIGSP MNF+P A +DG L++ Sbjct: 200 MTLGDKVAVMKDGIIQQFGTPQQIYNDPANQFVASFIGSPPMNFIPVRLARQDGRLLALL 259 Query: 261 GH---RLASPVGR---ALPAGALQVGIRPEYLALAQPQQAG--ALPGTVVQVQDIGTYQM 312 R P+G AL + +GIRPE +AL G A+ V + G + Sbjct: 260 DSGQARCELPLGEAADALEGREIILGIRPEQIALGAADGNGLPAIRAEVQVTEPTGPDLL 319 Query: 313 LTAKVGEHTVKARFTPETRLPSSGDTAWLQ 342 + + + V R P+ GDT LQ Sbjct: 320 VFVTLNQTKVCCRLAPDVAC-RVGDTLNLQ 348 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 323 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 384 Length adjustment: 30 Effective length of query: 328 Effective length of database: 354 Effective search space: 116112 Effective search space used: 116112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory