Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate PP_4751 PP_4751 Amino acid ABC transporter, ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >FitnessBrowser__Putida:PP_4751 Length = 269 Score = 174 bits (441), Expect = 2e-48 Identities = 97/227 (42%), Positives = 138/227 (60%), Gaps = 4/227 (1%) Query: 19 PALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGRILVEGEDVTA---LDAE 75 P L + G++ +IG SG+GKSTLLR IN+LE P+ GR+ ++G + A L Sbjct: 38 PVLHDVCFEMNKGEVVAIIGPSGSGKSTLLRCINQLEPPTKGRVSMDGVHIEAGKALPRT 97 Query: 76 GLRRFRQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDARVSELLARVGLSDHA 135 L + R+R+GM+FQ FNL TV N+++ G S E DAR +LL RVGL+D A Sbjct: 98 ELLKLRRRIGMVFQSFNLFPHLTVLRNVSLAQIRTLGRSAKEADARSLQLLERVGLADKA 157 Query: 136 RKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTASVLQLLAEINRELKLTI 195 + YPA+ SGGQ+QR+ IARALA P ++L DE TSALDP+ VL ++ E+ E +++ Sbjct: 158 QHYPARCSGGQQQRIAIARALALDPELMLFDEPTSALDPELGLEVLAVMKELAGE-GMSM 216 Query: 196 VLITHEMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHPQHPTTRRFV 242 +++THEM V D+V VM G I+E G V P+H +F+ Sbjct: 217 IVVTHEMHFAETVSDRVVVMADGRIIEHGPSQRVMREPEHERVIQFL 263 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 259 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 269 Length adjustment: 27 Effective length of query: 308 Effective length of database: 242 Effective search space: 74536 Effective search space used: 74536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory