Align D-methionine ABC transporter membrane protein, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate PP_0219 PP_0219 L,D-methionine D-methionine ABC transporter - permease subunit
Query= TCDB::Q9HT69 (225 letters) >FitnessBrowser__Putida:PP_0219 Length = 214 Score = 204 bits (518), Expect = 1e-57 Identities = 94/204 (46%), Positives = 142/204 (69%) Query: 22 VDTFWMLGGSLLFTVVLGLPLGVLLFLTGPRQMFEQKAVYTLLSLVVNILRSLPFIILLI 81 +DT M+G S L +++G+P+ VLL + +FE + + +L VN+ RS+PF+IL++ Sbjct: 11 LDTLLMVGVSSLIALLVGVPMAVLLVTSDKGGIFEARLLNRVLGAFVNLFRSIPFLILMV 70 Query: 82 VMIPLTVLITGTSLGVAGAIPPLVVGATPFFARLVETALREVDKGIIEATQAMGASTRQI 141 +IP T L+ GT+ GV A+ PL + ATPFFAR+ E +LREVD G++EA QAMG I Sbjct: 71 ALIPFTRLVVGTTYGVWAAVVPLTIAATPFFARIAEVSLREVDHGLVEAAQAMGCRRWHI 130 Query: 142 IWNALLPEARPGIIAAITVTAITLVSYTAMAGVVGAGGLGDLAIRFGYQRFQTDVMVVTV 201 +W+ LLPEA PGI+ T+T +TL++ +AMAG +GAGGLGD+A R+GYQRF + +M+ + Sbjct: 131 VWHVLLPEALPGIVGGFTITLVTLINSSAMAGAIGAGGLGDIAYRYGYQRFDSQIMLTVI 190 Query: 202 VMLLILVQILQTVGDKLVVHFSRK 225 ML+ LV ++Q GD+L +++ Sbjct: 191 AMLVALVALIQLGGDRLAKGLNKR 214 Lambda K H 0.329 0.143 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 225 Length of database: 214 Length adjustment: 22 Effective length of query: 203 Effective length of database: 192 Effective search space: 38976 Effective search space used: 38976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory