Align Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter periplasmic binding protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate PP_0227 PP_0227 periplasmic cystine-binding protein
Query= TCDB::Q9HU31 (250 letters) >FitnessBrowser__Putida:PP_0227 Length = 264 Score = 129 bits (325), Expect = 5e-35 Identities = 68/224 (30%), Positives = 131/224 (58%), Gaps = 10/224 (4%) Query: 27 LRIGTEGAYPPFNGIDASGQAVGFDLDIGKALCAKMKTECEVVTSDWDGIIPALNAKKFD 86 + +G EG YPPF+ D +G+ GF++++ + L ++ + ++ + WDGI+ AL +K+ D Sbjct: 40 INVGLEGTYPPFSFQDENGKLTGFEVELSELLAKELGVKAKIQPTKWDGILAALESKRLD 99 Query: 87 FIVASMSITDERKQAVDFTDPYYTNKLQFVAPK----SVDFKTDKDSLKGKVIGAQRATI 142 +V ++I++ERK+ DF++PY + +Q + K ++ K +D L GK +G T Sbjct: 100 VVVNQVTISEERKKKYDFSEPYTVSGIQALILKKKAEQLNIKGAQD-LAGKKVGVGLGTN 158 Query: 143 AGTWLEDNMADVVTIKLYDTQENAYLDLSSGRLDGVLADKFVQYDWLKSDAGKEFEFKGE 202 W++ ++ ++ Y+ + + DL +GR+D +L D+ ++ + K+ E G+ Sbjct: 159 YEQWVKKDVPQ-ADVRTYEDDPSKFADLRNGRIDAILIDRLAALEY--AQKAKDTELAGD 215 Query: 203 PVFDNDKIGIAVRKGDP-LREKLNAALKEIVADGTYKKINDKYF 245 F + G+A+RKG+P L +N A+ ++ ADGT K+++KYF Sbjct: 216 -AFSRLESGVALRKGEPELLAAINKAIDKLKADGTLAKLSEKYF 258 Lambda K H 0.317 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 264 Length adjustment: 24 Effective length of query: 226 Effective length of database: 240 Effective search space: 54240 Effective search space used: 54240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory