Align Histidine transport system permease protein HisQ (characterized)
to candidate PP_0656 PP_0656 putative Amino acid ABC transporter, permease protein
Query= SwissProt::P52094 (228 letters) >FitnessBrowser__Putida:PP_0656 Length = 273 Score = 112 bits (279), Expect = 9e-30 Identities = 71/218 (32%), Positives = 113/218 (51%), Gaps = 15/218 (6%) Query: 10 LQGALVTLELAISSVVLAVIIGLIGAGGKLSQNRLSGLIFEGYTTLIRGVPDLVLMLLIF 69 LQGA +TL L + S+V++V++G A +LS + + + YT+ RG P L+ +LLI+ Sbjct: 69 LQGAALTLFLCLCSMVVSVLLGFAAALARLSNSAVLVGVASFYTSFFRGTPLLIQILLIY 128 Query: 70 YGLQIALNTVTEAMGVGQIDIDP--MVAGIITLGFIYGAYFTETFRGAFMAVPKGHIEAA 127 GL Q+ + P + AGII L YGAY +E FR + V +G EAA Sbjct: 129 LGLP-------------QVGLVPGAISAGIIALSLNYGAYLSEIFRAGILGVARGQREAA 175 Query: 128 TAFGFTRGQVFRRIMFPSMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKATQLAGKST 187 A G Q+F I+ P MR +P N + +LK ++L+S++G+ +V+ Q G+S+ Sbjct: 176 LALGMRTPQIFCHIILPQAMRVIIPPTANQFISMLKDSSLISVMGVWEVMFLAQSYGRSS 235 Query: 188 WEPFYFAIVCGVIYLVFTTVSNGVLLFLERRYSVGVKR 225 + VIY V + + + LER + +R Sbjct: 236 YRYLEMLTTAAVIYWVLSILLELLQARLERHFGKAYQR 273 Lambda K H 0.328 0.145 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 273 Length adjustment: 24 Effective length of query: 204 Effective length of database: 249 Effective search space: 50796 Effective search space used: 50796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory