Align histidine permease (characterized)
to candidate PP_4495 PP_4495 aromatic amino acid transport protein
Query= reanno::pseudo3_N2E3:AO353_12275 (468 letters) >FitnessBrowser__Putida:PP_4495 Length = 472 Score = 373 bits (958), Expect = e-108 Identities = 190/449 (42%), Positives = 279/449 (62%), Gaps = 13/449 (2%) Query: 8 LKRGLSARHIRFMALGSAIGTGLFYGSASAIQMAGPAVLLAYLIGGAAVFMVMRALGEMA 67 LKRGL RHI+ +ALG AIGTGLF GSA ++ AGP+++L Y I G FM+MR LGEM Sbjct: 11 LKRGLKNRHIQLIALGGAIGTGLFLGSAGVMKSAGPSMILGYAICGFIAFMIMRQLGEMI 70 Query: 68 VHNPVAGSFGQYASTYLGPMAGFILGWTYAFEMVIVGMADVTAFGIYMGFWFPEVSRWIW 127 V PVAGSF +A TY G AGF+ GW ++VGM++++A G Y+ +W+PE+ W+ Sbjct: 71 VEEPVAGSFSHFAHTYWGGFAGFLSGWNCWVLYILVGMSELSAVGKYVHYWWPEIPTWVT 130 Query: 128 VLGVVSIVGGLNLCNVKVFGEMEFWLSLLKVAAIVAMILGGFGIMLFGISTAPGQVTDIS 187 ++ +NL NVK FGE EFW +++KV AIV+MI G G L S + G ++ Sbjct: 131 AAAFFVLINAINLMNVKFFGEAEFWFAIIKVVAIVSMI--GLGAYLL-TSGSGGPEATVA 187 Query: 188 NLWTQGGFMPNGMGGLIASFAVVMFAFGGIEIIGVTAGEAKDPQHVLPRAINAVPLRILL 247 NLWT GGF PNG+ GL+ + A +MF+FGG+E++G TA EA P+ V+P+AIN V RIL+ Sbjct: 188 NLWTHGGFFPNGVSGLVMALAFIMFSFGGLEMLGFTAAEADKPKTVIPKAINQVIYRILI 247 Query: 248 FYVLTMLVLMSIFPWQQI--------GSQG-SPFVQIFDKLGISSAATILNIVVITAAIS 298 FYV ++VL+S+ PW + GS G SPFVQ+F LG AA +LN VV+TAA+S Sbjct: 248 FYVGALVVLLSLTPWDNLVASIDASGGSYGSSPFVQVFSLLGSDVAANLLNFVVLTAALS 307 Query: 299 AINSDIFGAGRMMFGLAQQGHAPKGFAHLSRNGVPWMTVVVMSVALLLGVLLNYLIPENV 358 NS + RM+ G+A+QG AP A + + GVP +++V + + VLLNYL+P+N Sbjct: 308 VYNSGTYCNARMLLGMAEQGDAPASLAKVDKRGVPVRSILVSAAVTFVAVLLNYLMPQNA 367 Query: 359 FLLIASIATFATVWVWLMILFTQVAMRRSMTAEQVAQLKFPVPFWPYAPMAAIAFMLFVF 418 L+ S+ V W MI ++ + R+ + L F ++PY +AF++ + Sbjct: 368 LELLMSLVVATLVINWAMISYSHLKFRQHLDRTGQKPL-FKALWYPYGNYVVLAFVVLIL 426 Query: 419 GVLGYFPDTQAALIVGVVWIVLLVLAYLM 447 G++ P Q ++ VW++ +++ Y++ Sbjct: 427 GIMLMIPGIQVSVYAIPVWLLAMLVVYMV 455 Lambda K H 0.329 0.142 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 660 Number of extensions: 36 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 468 Length of database: 472 Length adjustment: 33 Effective length of query: 435 Effective length of database: 439 Effective search space: 190965 Effective search space used: 190965 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory