GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ech in Pseudomonas putida KT2440

Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (uncharacterized)
to candidate PP_3283 PP_3283 1,2-epoxyphenylacetyl-CoA isomerase

Query= curated2:P24162
         (257 letters)



>lcl|FitnessBrowser__Putida:PP_3283 PP_3283
           1,2-epoxyphenylacetyl-CoA isomerase
          Length = 263

 Score =  231 bits (588), Expect = 1e-65
 Identities = 122/263 (46%), Positives = 169/263 (64%), Gaps = 6/263 (2%)

Query: 1   MSYHTIRYEISEGLAVITLDRPEVMNALNAAMRHELTAALHRAR--GEARAIVLTGSGRA 58
           M++  I + I +G+A ++L+RPE +N+ N AM  E+  AL + R   +AR ++LT  GR 
Sbjct: 1   MTFQHILFSIEDGVAFLSLNRPEQLNSFNTAMHLEVREALRQVRQSSDARVLLLTAEGRG 60

Query: 59  FCSGQDLGDG----AAEGLNLETVLREEYEPLLQAIYSCPLPVLAAVNGAAAGAGANLAL 114
           FC+GQDL D      AE  +L   + + Y PL++ +   PLPV+ AVNG AAGAGAN+ L
Sbjct: 61  FCAGQDLSDRNVAPGAEMPDLGQSIDKFYNPLVRTLRDLPLPVICAVNGVAAGAGANIPL 120

Query: 115 AADVVIAAQSAAFMQAFTRIGLMPDAGGTWWLPRQVGMARAMGMALFAEKIGAEEAARMG 174
           A D+V+AA+SA+F+QAF +IGL+PD+GGTW LPR VGMARA  +A+  E++GAE+A + G
Sbjct: 121 ACDLVLAARSASFIQAFCKIGLVPDSGGTWLLPRLVGMARAKALAMLGERLGAEQAEQWG 180

Query: 175 LIWEAVPDVDFEHHWRARAAHLARGPSAAFAAVKKAFHAGLSNPLPAQLALEARLQGELG 234
           LI+  V D          A HLA  P+     +K++ +A   N   AQL LE  LQ   G
Sbjct: 181 LIYRVVDDAALRDEALTLARHLAAQPTYGLTLIKRSLNASFDNGFEAQLELERDLQRLAG 240

Query: 235 QSADFREGVQAFLEKRPPHFTGR 257
           +S D+REGV AF+ KR P F GR
Sbjct: 241 RSEDYREGVNAFMNKRTPAFKGR 263


Lambda     K      H
   0.321    0.133    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 159
Number of extensions: 7
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 257
Length of database: 263
Length adjustment: 24
Effective length of query: 233
Effective length of database: 239
Effective search space:    55687
Effective search space used:    55687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)

Align candidate PP_3283 PP_3283 (1,2-epoxyphenylacetyl-CoA isomerase)
to HMM TIGR02280 (paaB: phenylacetate degradation probable enoyl-CoA hydratase PaaB (EC 4.2.1.17))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02280.hmm
# target sequence database:        /tmp/gapView.22904.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02280  [M=256]
Accession:   TIGR02280
Description: PaaB1: phenylacetate degradation probable enoyl-CoA hydratase PaaB
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   1.5e-129  416.9   0.7   1.7e-129  416.8   0.7    1.0  1  lcl|FitnessBrowser__Putida:PP_3283  PP_3283 1,2-epoxyphenylacetyl-Co


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Putida:PP_3283  PP_3283 1,2-epoxyphenylacetyl-CoA isomerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  416.8   0.7  1.7e-129  1.7e-129       1     256 []       6     263 .]       6     263 .] 0.99

  Alignments for each domain:
  == domain 1  score: 416.8 bits;  conditional E-value: 1.7e-129
                           TIGR02280   1 illelekgvlrltlnrpdklnsfteemhaelaealerverdd.vrallltGaGrGfcaGqdlsernvtkg.aapd 73 
                                         il+++e+gv+ l+lnrp++lnsf+  mh e++eal +v++ + +r+lllt  GrGfcaGqdls+rnv +g ++pd
  lcl|FitnessBrowser__Putida:PP_3283   6 ILFSIEDGVAFLSLNRPEQLNSFNTAMHLEVREALRQVRQSSdARVLLLTAEGRGFCAGQDLSDRNVAPGaEMPD 80 
                                         899***********************************98766***************************99*** PP

                           TIGR02280  74 lGetvekfynplvrrlaalpkpvvvavnGvaaGaGanlalagdivlaaesakfiqafaklGlipdsGGtwllprl 148
                                         lG++++kfynplvr l+ lp+pv++avnGvaaGaGan+ la+d+vlaa+sa+fiqaf+k+Gl+pdsGGtwllprl
  lcl|FitnessBrowser__Putida:PP_3283  81 LGQSIDKFYNPLVRTLRDLPLPVICAVNGVAAGAGANIPLACDLVLAARSASFIQAFCKIGLVPDSGGTWLLPRL 155
                                         *************************************************************************** PP

                           TIGR02280 149 vGrarakglallgekldaetaaewGliwqvvddealadevqalaahlakqptrglalikralqaaetnsldtqld 223
                                         vG arak+la+lge+l ae+a++wGli++vvdd+al de+ +la+hla+qpt gl+likr+l+a+  n +++ql+
  lcl|FitnessBrowser__Putida:PP_3283 156 VGMARAKALAMLGERLGAEQAEQWGLIYRVVDDAALRDEALTLARHLAAQPTYGLTLIKRSLNASFDNGFEAQLE 230
                                         *************************************************************************** PP

                           TIGR02280 224 lerdlqrelGrsadyaeGvaafldkrepefkGk 256
                                         lerdlqr +Grs dy+eGv+af++kr+p fkG+
  lcl|FitnessBrowser__Putida:PP_3283 231 LERDLQRLAGRSEDYREGVNAFMNKRTPAFKGR 263
                                         *******************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (256 nodes)
Target sequences:                          1  (263 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.43
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory