Align Beta-ketothiolase BktB; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; EC 2.3.1.16; EC 2.3.1.9 (characterized)
to candidate PP_3754 PP_3754 Beta-ketothiolase BktB
Query= SwissProt::Q0KBP1 (394 letters) >FitnessBrowser__Putida:PP_3754 Length = 394 Score = 497 bits (1280), Expect = e-145 Identities = 248/391 (63%), Positives = 295/391 (75%), Gaps = 1/391 (0%) Query: 4 EVVVVSGVRTAIGTFGGSLKDVAPAELGALVVREALARAQVSGDDVGHVVFGNVIQTEPR 63 E+ VVS VR+AIG FGGSLKD+ A+L + V R A+ R+ ++ + VGH+V G VI TEPR Sbjct: 5 EIYVVSAVRSAIGGFGGSLKDLPLADLASAVTRAAIERSGLAAEQVGHMVMGTVIPTEPR 64 Query: 64 DMYLGRVAAVNGGVTINAPALTVNRLCGSGLQAIVSAAQTILLGDTDVAIGGGAESMSRA 123 D YL RVAA+N G+ PA VNRLCGSGLQAIVSAAQ +LLGDTDVA+ GAESMSR Sbjct: 65 DAYLARVAAMNAGIPKETPAFNVNRLCGSGLQAIVSAAQGLLLGDTDVAVAAGAESMSRG 124 Query: 124 PYLAPAARWGARMGDAGLVDMMLGALHDPFHRIHMGVTAENVAKEYDISRAQQDEAALES 183 PYL P ARWGARMGD +D +G L DPF HMG+TAENV+ +Y I+R QDE AL S Sbjct: 125 PYLLPQARWGARMGDLQGIDYTVGVLQDPFQHFHMGITAENVSAKYGITREMQDELALTS 184 Query: 184 HRRASAAIKAGYFKDQIVPVVSKGRKGDVTFDTDEHVRHDATIDDMTKLRPVFVKENGTV 243 RRA+ AI G F QIV + K RKG V F DEHVR D T + + ++PVF K++GTV Sbjct: 185 QRRAARAIAEGRFASQIVALELKTRKGSVQFSVDEHVRADVTAEQLAGMKPVF-KKDGTV 243 Query: 244 TAGNASGLNDAAAAVVMMERAEAERRGLKPLARLVSYGHAGVDPKAMGIGPVPATKIALE 303 TAGNASG+ND AA +V+ R GLKPLARLV Y HAGV+P+ MG+GP+PAT+ LE Sbjct: 244 TAGNASGINDGAAGLVLATGDAVRRLGLKPLARLVGYAHAGVEPELMGLGPIPATRKVLE 303 Query: 304 RAGLQVSDLDVIEANEAFAAQACAVTKALGLDPAKVNPNGSGISLGHPIGATGALITVKA 363 + GL + DLDVIE+NEAFAAQACAV + LG DP KVNPNGSGISLGHP+GATGA+I KA Sbjct: 304 KTGLNLQDLDVIESNEAFAAQACAVARELGFDPEKVNPNGSGISLGHPVGATGAIIATKA 363 Query: 364 LHELNRVQGRYALVTMCIGGGQGIAAIFERI 394 +HEL R+QGRYAL TMCIGGGQGIA +FER+ Sbjct: 364 IHELQRIQGRYALATMCIGGGQGIAVVFERV 394 Lambda K H 0.318 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 474 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 394 Length adjustment: 31 Effective length of query: 363 Effective length of database: 363 Effective search space: 131769 Effective search space used: 131769 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate PP_3754 PP_3754 (Beta-ketothiolase BktB)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.1580.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-138 448.3 4.5 1.3e-138 448.1 4.5 1.0 1 lcl|FitnessBrowser__Putida:PP_3754 PP_3754 Beta-ketothiolase BktB Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Putida:PP_3754 PP_3754 Beta-ketothiolase BktB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 448.1 4.5 1.3e-138 1.3e-138 1 385 [] 8 392 .. 8 392 .. 0.98 Alignments for each domain: == domain 1 score: 448.1 bits; conditional E-value: 1.3e-138 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageq.aniaReaalaaglpesv 74 +v+avR++ig +ggslk+l+ +dL++av ++++er+gl +e++ ++++G+v+++ a +aR aa++ag+p+++ lcl|FitnessBrowser__Putida:PP_3754 8 VVSAVRSAIGGFGGSLKDLPLADLASAVTRAAIERSGLAAEQVGHMVMGTVIPTEPRdAYLARVAAMNAGIPKET 82 79********99*****************************************99988***************** PP TIGR01930 75 paltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakledqllkdl..vkt 147 pa++vnr+C+SglqA+ +aaq + G+ dv+va+G+EsmSr p+ll+++ r+++++g+ + d ++ l + + lcl|FitnessBrowser__Putida:PP_3754 83 PAFNVNRLCGSGLQAIVSAAQGLLLGDTDVAVAAGAESMSRGPYLLPQA--RWGARMGDLQGIDYTVGVLqdPFQ 155 ***********************************************98..89*****99999977776699999 PP TIGR01930 148 klsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk..kkvvskDegirpnttlekL 220 +++mg+tAen+++kygi+Re+qDe+al S+++aa+Ai+eg+f+++iv +e+k++ ++++s De++r+++t+e+L lcl|FitnessBrowser__Putida:PP_3754 156 HFHMGITAENVSAKYGITREMQDELALTSQRRAARAIAEGRFASQIVALELKTRkgSVQFSVDEHVRADVTAEQL 230 ****************************************************99999****************** PP TIGR01930 221 akLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplarivsaavagvdpeemglgpvpAiekaLk 295 a++kp+fk+ +g tvtAgN+s++nDGAa l+l++ +++++lgl+plar+v++a+agv+pe mglgp+pA++k+L+ lcl|FitnessBrowser__Putida:PP_3754 231 AGMKPVFKK-DG-TVTAGNASGINDGAAGLVLATGDAVRRLGLKPLARLVGYAHAGVEPELMGLGPIPATRKVLE 303 *******95.9*.6************************************************************* PP TIGR01930 296 kaglsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAiAlGHPlGasGarivltllkeLkergkkyGla 370 k+gl+++d+d++E nEAFAaq+ av++elg d+ekvN nG+ i+lGHP+Ga+Ga+i ++ ++eL++ +++y+la lcl|FitnessBrowser__Putida:PP_3754 304 KTGLNLQDLDVIESNEAFAAQACAVARELG-FDPEKVNPNGSGISLGHPVGATGAIIATKAIHELQRIQGRYALA 377 ******************************.78****************************************** PP TIGR01930 371 tlCvggGqGaAvile 385 t+C+ggGqG+Av++e lcl|FitnessBrowser__Putida:PP_3754 378 TMCIGGGQGIAVVFE 392 *************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (394 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.04 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory