Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate PP_1951 PP_1951 Oxidoreductase, short chain dehydrogenase/reductase family
Query= metacyc::MONOMER-11802 (255 letters) >FitnessBrowser__Putida:PP_1951 Length = 275 Score = 122 bits (305), Expect = 1e-32 Identities = 95/264 (35%), Positives = 138/264 (52%), Gaps = 24/264 (9%) Query: 9 IVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEA---KARELGDNARFAVADISDEQA 65 IV+GAASGLG A + + E+GA+V ++DLN +A++A + R LG + R V D++D A Sbjct: 15 IVTGAASGLGLAFTEAMAESGAQVAMLDLNREALDAQFRRLRSLGYSVRSHVLDVTDRDA 74 Query: 66 AQSAVDAAVSAFGSLHGLVNCAGI-----VGAEKVLGKQGPHGLAS------FAKVINVN 114 +A + FG L + AGI A G++ P + + KVI+V+ Sbjct: 75 VDDTFNAVAAGFGGLDIVFANAGIDPGPGFAALNAAGEREPANMLEEYSDHRWRKVISVS 134 Query: 115 LIGSFNLLRLAAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLP 174 L F +R AA M A+ SG +I+ T+ A AAYAA+K A L Sbjct: 135 LDAVFYSIRAAARHM---RANRSG--SIIVTTSVSALRPAVTLGAAYAAAKAGAAQLVRA 189 Query: 175 AARELARFGIRVMTIAPGIFETPMMAGM--SDEVRASLAAGVPFPPRLGRPQEYAALARH 232 A ELA G+RV IAPG FET + G + EVRA +AAGVP R+ +E LA + Sbjct: 190 TALELASDGVRVNAIAPGPFETDIGGGFMHNSEVRAKMAAGVPM-GRIAEVEEIKPLALY 248 Query: 233 IIE--NSMLNGEVIRLDGALRMAA 254 + +S + G+ +DG L ++A Sbjct: 249 LASKASSFVTGQQFVIDGGLSLSA 272 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 102 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 275 Length adjustment: 25 Effective length of query: 230 Effective length of database: 250 Effective search space: 57500 Effective search space used: 57500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory