Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate PP_1953 PP_1953 Oxidoreductase, short chain dehydrogenase/reductase family
Query= BRENDA::Q99714 (261 letters) >FitnessBrowser__Putida:PP_1953 Length = 269 Score = 131 bits (330), Expect = 1e-35 Identities = 100/276 (36%), Positives = 135/276 (48%), Gaps = 31/276 (11%) Query: 7 SVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVT 66 S + + V+TG ASG+G ATA+ LV QGA V +DL S QA + + P DV+ Sbjct: 2 SFQNKIVVLTGAASGIGKATAQLLVEQGAHVVAMDL-KSDLLQQAFGSEEHVLCIPTDVS 60 Query: 67 SEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYN-------------LKKGQTHTLE- 112 + V+ A KFGRVDV +N AGI ++ N +K G+ T + Sbjct: 61 DSEAVRAAFQAVDAKFGRVDVIINAAGINAPTREANQKMVDANVAALDAMKSGRAPTFDF 120 Query: 113 -------DFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQ 165 DF+RV++VNL F IR M + GG G I+N +SVAA G Sbjct: 121 LADTSDQDFRRVMEVNLFSQFYCIREGVPLMRR----AGG--GSIVNISSVAALLGVAMP 174 Query: 166 AAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPS 225 Y ASK ++G+T A +LAP IRV IAPG TPL+ P +V FL S P Sbjct: 175 LYYPASKAAVLGLTRAAAAELAPYNIRVNAIAPGSVDTPLMHEQPPEVVQFLVSMQPI-K 233 Query: 226 RLGDPAEYAH--LVQAIIENPFLNGEVIRLDGAIRM 259 RL P E A L A + F+ G+ + +G + M Sbjct: 234 RLAQPEELAQSILFLAGEHSSFITGQTLSPNGGMHM 269 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 269 Length adjustment: 25 Effective length of query: 236 Effective length of database: 244 Effective search space: 57584 Effective search space used: 57584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory