GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pccA in Pseudomonas putida KT2440

Align propionyl-CoA carboxylase (subunit 2/2) (EC 6.4.1.3) (characterized)
to candidate PP_4067 PP_4067 methylcrotonyl-CoA carboxylase biotin-containing subunit alpha

Query= BRENDA::Q19842
         (724 letters)



>lcl|FitnessBrowser__Putida:PP_4067 PP_4067 methylcrotonyl-CoA
           carboxylase biotin-containing subunit alpha
          Length = 650

 Score =  501 bits (1289), Expect = e-146
 Identities = 291/679 (42%), Positives = 407/679 (59%), Gaps = 32/679 (4%)

Query: 45  NEPKFDKILIANRGEIACRVIKTARAMGIKTVAVHSDVDSNSLHVKMADEAVCVGEAPTA 104
           + P    +L+ANRGEIACRV++TA+AMG+ TVAVHS  D ++ H + AD  V +G    A
Sbjct: 2   SRPALTTLLVANRGEIACRVMRTAKAMGLTTVAVHSATDRDARHSREADIRVDLGGTKAA 61

Query: 105 KSYLRADRILQAVEDTGAQAVHPGYGFLSENTKFAAELEKAGAKFIGPNSKAILDMGDKI 164
           +SYL  D++L A + +GAQA+HPGYGFLSEN  FA  +E+AG  F+GP + AI  MG K 
Sbjct: 62  ESYLLVDKLLAAAKASGAQAIHPGYGFLSENAGFARAIEQAGLIFLGPPASAIDAMGSKS 121

Query: 165 HSKKIATAARVSMIPGYDGEIADEDMCVKVSRDIGYPVMIKASAGGGGKGMRVAWNDKQA 224
            +K +  AA V ++PGY GE  D D     +  IGYPV++KASAGGGGKGM+V   + Q 
Sbjct: 122 AAKALMEAAGVPLVPGYHGEAQDLDTFRAAAERIGYPVLLKASAGGGGKGMKVVEEESQL 181

Query: 225 REGYRLSKQEAASSFGDDRMLVEKFIDNPRHIEMQVLCDKHGNALWLNERECSIQRRNQK 284
            +    +++EA SSFGD RMLVEK++  PRH+E+QV  D+HGN L+LNER+CSIQRR+QK
Sbjct: 182 ADALASAQREAQSSFGDARMLVEKYVLKPRHVEIQVFADQHGNCLYLNERDCSIQRRHQK 241

Query: 285 VIEEAPSSFVPPEMRRKMGEQAVQLAKAVGYDSAGTVEFLVDSQRNFYFLEMNTRLQVEH 344
           V+EEAP+  + PE+RR MGE AV+ A+A+GY  AGTVEFL+D++  F+F+EMNTRLQVEH
Sbjct: 242 VVEEAPAPGLSPELRRAMGEAAVRAAQAIGYVGAGTVEFLLDARGEFFFMEMNTRLQVEH 301

Query: 345 PITECITGIDIVQQMLRVSYGHPLPITQEQVPLNGWAFESRVYAEDPYKGFGLPSVGRLS 404
           P+TE ITG+D+V   +RV+ G  LPITQEQVPL G A E R+YAEDP   F LP+ G+L+
Sbjct: 302 PVTEAITGLDLVAWQIRVACGEALPITQEQVPLIGHAIEVRLYAEDPANDF-LPATGKLA 360

Query: 405 RYVEPKHVDGVRCDSGIREGSEISIYYDPLICKLVTHGDNREQALNRMQEALDNYVIRGV 464
            Y E    +G R DSG+ EG  +S +YDP++ KL+  G++REQA  R+   LD + I G+
Sbjct: 361 LYRESAPGEGRRVDSGVSEGDVVSPFYDPMLGKLIAWGEDREQARLRLLAMLDEFAIGGL 420

Query: 465 THNIPLLRDIVQEKRFRTGDITTKYLPEVYPEGFQGTSLSPKEQDVVIAFASALNARKLA 524
             NI  LR I+    F   ++ T ++              P+ QDV++    AL A    
Sbjct: 421 KTNIAFLRRILAHPAFAAAELDTGFI--------------PRHQDVLLPAPRALPAAFWE 466

Query: 525 RANQFLNQNKQRSTHVASFSKTYKFVSSLPVKEGERPTEHAVEVEFVEGSANKAQVRIGG 584
            A +   Q +            +   + L +    R + H V     +  A +   R   
Sbjct: 467 AAAEAWLQGQAGHQREDDRHSPWSGSNGLRLGLPARSSLHLVSAGQDQAVALE---RSAA 523

Query: 585 KTVTISGDLNLSHPVNSIEVDGEHITTQIVGKRAGEITVLYKGTPFKVKVLPEQAVKYLQ 644
            T  + G+  L H  N +    +H+      +R G + + ++G    ++     A     
Sbjct: 524 STWQLQGE-QLVHDQNGVR--RQHLAI----RRGGTLYLHWEGEMHAIEAFDPIA----- 571

Query: 645 YMKEKAKVDLSTVVLSPMPGAIKNVNVKPGDMVSEGQELVVMEAMKMQNSLHAGKTGRVK 704
             + +A       + +PM G+I  V V+PG +V  G  L+V+EAMKM++S+ A   G VK
Sbjct: 572 --EAEASHSHQGGLGAPMNGSIVRVLVEPGQVVEAGTALLVLEAMKMEHSIRAPHAGTVK 629

Query: 705 AVNVKVGATVDEGEVLVEL 723
           A+    G  V EG VLVEL
Sbjct: 630 ALFCLEGDMVSEGTVLVEL 648


Lambda     K      H
   0.316    0.133    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1086
Number of extensions: 36
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 3
Length of query: 724
Length of database: 650
Length adjustment: 39
Effective length of query: 685
Effective length of database: 611
Effective search space:   418535
Effective search space used:   418535
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory