Align D-gluconate dehydrogenase cytochrome c subunit (EC 1.1.99.3) (characterized)
to candidate PP_3623 PP_3623 Alcohol dehydrogenase cytochrome c subunit
Query= metacyc::MONOMER-12746 (434 letters) >FitnessBrowser__Putida:PP_3623 Length = 447 Score = 400 bits (1028), Expect = e-116 Identities = 211/405 (52%), Positives = 268/405 (66%), Gaps = 12/405 (2%) Query: 15 AAANAAEADQQALVQQGEYLARAGDCVACHTAKDGKPFAGGLPMETPIGVIYSTNITPDK 74 A A A AD ALV +GEY+AR DCVACH+ GKPFAGGL M TP+G I++TNITPD+ Sbjct: 36 ADAQATAADP-ALVSRGEYVARLSDCVACHSLPGGKPFAGGLEMATPLGAIHATNITPDR 94 Query: 75 -TGIGDYSFEDFDKAVRHGVAKGGSTLYPAMPFPSYARVSDADMQALYAYFMKGVAPVAR 133 +GIG+Y+ DFD+AVR GVA GG LYPAMP+PSYA++SD D++ALYA+FM GV P + Sbjct: 95 DSGIGNYTLADFDRAVRQGVAPGGRRLYPAMPYPSYAKLSDDDVKALYAFFMHGVQPARQ 154 Query: 134 DNQDSDIPWPLSMRWPLSIWRWMFAPSVETP-APAAGSDPVISRGAYLVEGLGHCGACHT 192 N SDIPWPL++RWP+++W +FA + TP AG D +RGAY+V+G GHCG+CHT Sbjct: 155 ANLGSDIPWPLNLRWPIALWNGLFAAT--TPYTDKAGQDAQWNRGAYIVQGPGHCGSCHT 212 Query: 193 PRALTMQEKALSASGGSDFLSGSAPLEGWIAKSLRGDHKDGLGSWSEEQLVQFLKTGRSD 252 PR L EKAL S G FLSG A L+GW A SLR DH GLG WSE ++ QFLKTGR+ Sbjct: 213 PRGLAFNEKALDDS-GKPFLSG-ALLDGWYAPSLRADHNTGLGRWSEAEIAQFLKTGRNR 270 Query: 253 RSAVFGGMSDVVVHSMQYMTDADLTAIARYLKSLPANDPKD-QPHQYDKQVAQALWNGDD 311 + V+G M++ +S Q+M D DL AIA YLKSLP + +D P Y A++L D Sbjct: 271 HAVVYGSMTEAFNNSTQFMHDDDLAAIAHYLKSLPGDPQRDGAPWHYQ---AESLATRLD 327 Query: 312 SKPGAAVYIDNCAACHRTDGHGYTRVFPALAGNPVLQSADATSLIHIVLKGGTLPATHSA 371 S PGA Y+ CA+CH DG G P LAG + ++ S I+I L G Sbjct: 328 S-PGARTYVTRCASCHGLDGKGQAEWMPPLAGATSALAKESASAINITLNGSQRVVAAGV 386 Query: 372 PSTFTMPAFAWRLSDQEVADVVNFIRSSWGNQASAVKPGDVAALR 416 P + MPA +LSDQE+ADV++F+R++WGNQ AV V LR Sbjct: 387 PDAYRMPALREQLSDQEIADVLSFVRTAWGNQGGAVDAQAVGKLR 431 Lambda K H 0.316 0.131 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 639 Number of extensions: 34 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 447 Length adjustment: 32 Effective length of query: 402 Effective length of database: 415 Effective search space: 166830 Effective search space used: 166830 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory