Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate PP_0762 PP_0762 Glycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >FitnessBrowser__Putida:PP_0762 Length = 321 Score = 141 bits (356), Expect = 2e-38 Identities = 96/300 (32%), Positives = 149/300 (49%), Gaps = 11/300 (3%) Query: 13 DVLAYLQQHAQVVQVDATQHDAFVAALKDADGGIGSSVKITPAMLEGATRLKALSTISVG 72 D+ QQ Q AT+ + L+ A + + V + A L +LK + + G Sbjct: 21 DLSPLKQQFDQFELFAATRPEQVAERLQGAVAVVSNKVMLDAATLAANPQLKLILVAATG 80 Query: 73 FDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVELAEWVKAGHWQHSIGP 132 + D+A +GI + N T S A +L+LA A R+ + + V G W + Sbjct: 81 TNNVDLAAARAQGITVCNCQGYGTPSVAQHTLALLLALATRLCDYNQAVADGQWAKASQF 140 Query: 133 ALFG---VDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRSANPQAEEAYGARRVE 189 L V+++GKTLG++G G +GGAVAR A F M+VL P+ A R+ Sbjct: 141 CLLDFPIVELEGKTLGLLGHGELGGAVARLAE-AFGMRVLSGQIPGRPER-----ADRLP 194 Query: 190 LAELLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNG 249 L ELL D + L PL T+H++GA EL +K +A+++N +RG +DE+AL +AL+ G Sbjct: 195 LDELLPQVDALTLHCPLNEHTRHMLGARELALLKPNALVVNTARGGLIDEQALADALRGG 254 Query: 250 TIHGAGLDVFETEPLPSDSPLLK--LANVVALPHIGSATHETRHAMARNAAENLVAALDG 307 + GA DV EP + +PLL+ + ++ PH E+R + +EN A G Sbjct: 255 HLGGAATDVLSVEPPVNGNPLLEPGIPRLIITPHSAWGAVESRQRIVGQLSENAQAFFAG 314 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 321 Length adjustment: 28 Effective length of query: 293 Effective length of database: 293 Effective search space: 85849 Effective search space used: 85849 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory