GapMind for catabolism of small carbon sources

 

Aligments for a candidate for brnQ in Pseudomonas putida KT2440

Align Branched chain amino acid transporter 2 of 439 aas and 12 TMSs, BrnQ (characterized)
to candidate PP_4184 PP_4184 branched chain amino acid transporter

Query= TCDB::P0AD99
         (439 letters)



>lcl|FitnessBrowser__Putida:PP_4184 PP_4184 branched chain amino
           acid transporter
          Length = 437

 Score =  588 bits (1517), Expect = e-173
 Identities = 291/428 (67%), Positives = 353/428 (82%)

Query: 5   LRSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAAFGFLITAVGLPVLTVVALA 64
           L+ +DI+ALGFMTFALFVGAGNIIFPP+VGLQ+G HVW AA GFL+TAVGLPV+TVVALA
Sbjct: 4   LKGQDILALGFMTFALFVGAGNIIFPPIVGLQSGPHVWMAALGFLVTAVGLPVITVVALA 63

Query: 65  KVGGGVDSLSTPIGKVAGVLLATVCYLAVGPLFATPRTATVSFEVGIAPLTGDSALPLFI 124
           KVGGG+D+LS+PIGK  G LLA VCYL+VGPLFATPRTATVSFEVG+APLTG+S L LFI
Sbjct: 64  KVGGGMDALSSPIGKFFGGLLAAVCYLSVGPLFATPRTATVSFEVGVAPLTGESPLALFI 123

Query: 125 YSLVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILSVAAIVWPAGSISTATEAYQNA 184
           YSLVYF +V+ VS+YPGKLLDTVG FLAPLKIIAL +L +AA   PAGSI  A  AY  A
Sbjct: 124 YSLVYFIVVLAVSMYPGKLLDTVGRFLAPLKIIALAVLGIAAFALPAGSIGDAQPAYAAA 183

Query: 185 AFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEARLLTRYTVWAGLMAGVGLTLLYL 244
           AFS GF +GYLTMDTLGA+VFGIVIVNA RSRGV   RL+TRY + AGL+AGVGL L+Y+
Sbjct: 184 AFSKGFSDGYLTMDTLGALVFGIVIVNAIRSRGVESPRLITRYAIIAGLIAGVGLALVYI 243

Query: 245 ALFRLGSDSASLVDQSANGAAILHAYVQHTFGGGGSFLLAALIFIACLVTAVGLTCACAE 304
           +LFRLG+ S  +   + NGAA+LHAYVQHTFG  GS  LA LI +ACLVTAVGLTCACAE
Sbjct: 244 SLFRLGATSHDIAADATNGAAVLHAYVQHTFGSLGSGFLAVLIALACLVTAVGLTCACAE 303

Query: 305 FFAQYVPLSYRTLVFILGGFSMVVSNLGLSQLIQISVPVLTAIYPPCIALVVLSFTRSWW 364
           +F+Q +PLSYR LV IL GFS+++SNLGL++LI  S+PVLTAIYPPCI +V LSF +  W
Sbjct: 304 YFSQILPLSYRALVVILAGFSLLISNLGLTKLIMFSIPVLTAIYPPCIVVVGLSFVKDLW 363

Query: 365 HNSSRVIAPPMFISLLFGILDGIKASAFSDILPSWAQRLPLAEQGLAWLMPTVVMVVLAI 424
           ++ +R++AP M +SLLFG++D IK S+ + +LP +   LPL++ G+AWL+P+VV +V A+
Sbjct: 364 NSPTRILAPVMLVSLLFGMVDAIKGSSLAHVLPDFMAHLPLSDAGMAWLVPSVVTLVGAV 423

Query: 425 IWDRAAGR 432
             DR  G+
Sbjct: 424 ACDRMLGK 431


Lambda     K      H
   0.327    0.140    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 696
Number of extensions: 20
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 439
Length of database: 437
Length adjustment: 32
Effective length of query: 407
Effective length of database: 405
Effective search space:   164835
Effective search space used:   164835
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory