Align 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic; 3-hydroxy-3-methylglutaryl-CoA lyase-like protein 1; EC 4.1.3.4 (characterized)
to candidate PP_3394 PP_3394 putative 3-hydroxy-3-methylglutaryl-CoA lyase
Query= SwissProt::D4A5C3 (343 letters) >FitnessBrowser__Putida:PP_3394 Length = 309 Score = 192 bits (489), Expect = 7e-54 Identities = 108/281 (38%), Positives = 164/281 (58%), Gaps = 3/281 (1%) Query: 48 VKIVEVGPRDGLQNEKVIVPTDIKIEFINQLSQTGLSVIEVTSFVSSRWVPQMADHAEVM 107 + I EVG RDGLQ+ +VI+PT K +I+ G+ +EV SFV +R +PQMAD EV+ Sbjct: 4 ITINEVGLRDGLQSLQVIMPTAAKRRWIDAAYGAGVRHMEVASFVPARLLPQMADAREVV 63 Query: 108 GGIHQYPGVRYPVLVPNLQGLQHAVAAGATEIAVFGAASESFSKKNIN---CSIEESMGR 164 YP ++ VL PNL+G + A+ +GA I + S + S N+ + E +GR Sbjct: 64 AHALTYPDLQVTVLAPNLRGARDALESGAHRIVAPVSVSTAHSLANVRRTPVEMVEELGR 123 Query: 165 FEQVISSARHMNIPVRGYVSCALGCPYEGSIMPQKVTEVSKRLYSMGCYEISLGDTVGVG 224 Q+ + + V +S A GC +G + + +++++ GC +SLGDT G Sbjct: 124 MCQLRTEMGLHGVQVVAGMSVAFGCTRQGEVPLADLCALTRQVIEAGCDLVSLGDTTGYA 183 Query: 225 TPGSMKTMLESVMKEIPPGALAVHCHDTYGQALANILTALQMGINVVDSAVSGLGGCPYA 284 PG + +L++V + A H HDT G ALAN L A+Q GI +D++++GLGGCP+A Sbjct: 184 NPGQVAMVLQAVREIAGDRLKAAHFHDTRGLALANSLVAVQQGIGELDASLAGLGGCPFA 243 Query: 285 KGASGNVATEDLIYMLNGMGLNTGVDLHKVMEAGDFICKAV 325 GASGN TEDL++ML MG +TG+DL ++E + +A+ Sbjct: 244 PGASGNTVTEDLVFMLQSMGYDTGIDLPALIETRQVLSEAL 284 Lambda K H 0.316 0.132 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 309 Length adjustment: 28 Effective length of query: 315 Effective length of database: 281 Effective search space: 88515 Effective search space used: 88515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory