Align ABC transporter for L-Lysine, periplasmic substrate-binding component (characterized)
to candidate PP_0227 PP_0227 periplasmic cystine-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09900 (251 letters) >FitnessBrowser__Putida:PP_0227 Length = 264 Score = 138 bits (348), Expect = 1e-37 Identities = 84/263 (31%), Positives = 150/263 (57%), Gaps = 22/263 (8%) Query: 1 MQTYKKFLLAAAVSLVFSAN----AMAADKLK---------MGIEAAYPPFNNKDASGQV 47 M + K LL A+++L+ A A A ++LK +G+E YPPF+ +D +G++ Sbjct: 1 MSKFAKPLLNASLALLLGAGLLSQAFAGEQLKTIQEKGVINVGLEGTYPPFSFQDENGKL 60 Query: 48 VGFDKDIGDALCAKMKVECEVVTSDWDGIIPALNAKKFDFLISSLSITEERKQAVDFTDP 107 GF+ ++ + L ++ V+ ++ + WDGI+ AL +K+ D +++ ++I+EERK+ DF++P Sbjct: 61 TGFEVELSELLAKELGVKAKIQPTKWDGILAALESKRLDVVVNQVTISEERKKKYDFSEP 120 Query: 108 YYSNKLQ-FIAPKSAEFKTDK--DSLKGKVIGAQRATLAGTWLEDEL-GSDITTKLYDTQ 163 Y + +Q I K AE K L GK +G T W++ ++ +D+ T Y+ Sbjct: 121 YTVSGIQALILKKKAEQLNIKGAQDLAGKKVGVGLGTNYEQWVKKDVPQADVRT--YEDD 178 Query: 164 ENAYLDLTSGRVDAILADKYVNYDWLKTEAGRAYEFKGDPVVESDKIGIAVRKGDNELRN 223 + + DL +GR+DAIL D+ ++ + + E GD + G+A+RKG+ EL Sbjct: 179 PSKFADLRNGRIDAILIDRLAALEY--AQKAKDTELAGDAFSRLES-GVALRKGEPELLA 235 Query: 224 KLNAALKEIVADGTYKKINDKYF 246 +N A+ ++ ADGT K+++KYF Sbjct: 236 AINKAIDKLKADGTLAKLSEKYF 258 Lambda K H 0.316 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 264 Length adjustment: 24 Effective length of query: 227 Effective length of database: 240 Effective search space: 54480 Effective search space used: 54480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory