Align Lysine/ornithine decarboxylase; LDC; EC 4.1.1.17; EC 4.1.1.18 (uncharacterized)
to candidate PP_0864 PP_0864 ornithine decarboxylase
Query= curated2:O50657 (393 letters) >FitnessBrowser__Putida:PP_0864 Length = 387 Score = 174 bits (440), Expect = 5e-48 Identities = 118/366 (32%), Positives = 186/366 (50%), Gaps = 12/366 (3%) Query: 9 KEVKTLAKRIPTPFLVASLDKVEENYQFMRRHLPRAGVFYAMKANPTPEILSLLAGLGSH 68 +++K A + TPF++ + + Y +R A V+YA+KANP EI+ LL GS Sbjct: 15 QKMKAFADKQETPFVLIDTQMISQAYDDLRAGFEFAKVYYAVKANPAVEIIDLLKEKGSS 74 Query: 69 FDVASAGEMEILHELGVDGSQMIYANPVKDARGLKAAADYNVRRFTFDDPSEIDKMAKAV 128 FD+AS E++ + GV ++ Y N +K ++ ++ + VR + D +++ +AKA Sbjct: 75 FDIASIYELDKVMGRGVSADRISYGNTIKKSKDIRYFYEKGVRLYATDSEADLRNIAKAA 134 Query: 129 PGADVLVRIAVR-NNKALVDLNTKFGAPVEEALDLLKAAQDAGLHAMGICFHVGSQSLST 187 PG+ V VRI + A L+ KFG + A+DLL A+D GL GI FHVGSQ Sbjct: 135 PGSKVYVRILTEGSTTADWPLSRKFGCQTDMAMDLLILARDLGLVPYGISFHVGSQQRDI 194 Query: 188 AAYEEALLVARRLFDE-AEEMGMHLTDLDIGGGFPVPDAKGLNVDLAAMMEAINKQIDRL 246 + ++ A+ + +F+ EE G+ L +++GGGFP N L E I + + Sbjct: 195 SVWDAAIAKVKVIFERLKEEDGIELKLINMGGGFPANYITRTN-SLETYAEEIIRFLKED 253 Query: 247 FPD--TAVWTEPGRYMCGTAVNLVTSV--IGTKTR-GEQPWYILDEGIYGCFSGIMYDHW 301 F D + EPGR + A LV+ V + K+R + W D G + M + Sbjct: 254 FGDELPEIILEPGRSLIANAGILVSEVVLVARKSRTAVERWIYTDVGKFSGLIETMDEAI 313 Query: 302 TYPLHCFGKGNKKPSTFGGPSCDGIDVLYRDF---MAPELKIGDKVLVTEMGSY-TSVSA 357 +P+ KG + GP+CD D++Y ++ + L IGD++ G+Y TS SA Sbjct: 314 KFPIWTEKKGEAEEVVIAGPTCDSADIMYENYKYGLPLNLAIGDRLYWLSTGAYTTSYSA 373 Query: 358 TRFNGF 363 FNGF Sbjct: 374 VEFNGF 379 Lambda K H 0.320 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 387 Length adjustment: 31 Effective length of query: 362 Effective length of database: 356 Effective search space: 128872 Effective search space used: 128872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory