Align 5-aminopentanamidase (EC 3.5.1.30) (characterized)
to candidate PP_3846 PP_3846 (R)-stereoselective amidase
Query= BRENDA::B3IVI7 (264 letters) >FitnessBrowser__Putida:PP_3846 Length = 271 Score = 147 bits (371), Expect = 2e-40 Identities = 99/257 (38%), Positives = 136/257 (52%), Gaps = 7/257 (2%) Query: 1 MRIALYQGAPKPLDVPGNLQRLRHQAQLAAERGAQLLVCPEMFLTGYNIGLAQVERLAEA 60 M+I L Q + + D NL+R QA LL+ PE L G+ Q+ +AE Sbjct: 1 MKIELVQLSGRDGDTAYNLERTL-QAIATCAVDTDLLIFPETQLMGF-ASAQQLAEIAEP 58 Query: 61 ADGPAAMTVVEIAQAHRIAIVYGYPERGDDGAIYNSVQLIDAHGRSLSNYRKTHLFGELD 120 +GP+ V ++ V G E D G +YN+ L+ G +LS YRKTHL+ + Sbjct: 59 VNGPSVQAVQRAVHERNVSAVIGLAEN-DSGTVYNTSLLVTPQGIALS-YRKTHLWPS-E 115 Query: 121 RSMFSPGADHFPVVELEGWKVGLLICYDIEFPENARRLALDGAELILVPTANMTPYDFTC 180 R +F G D + +G +VG+LICYDIEFPE+AR L GAELILV NM PY Sbjct: 116 RGLFQQG-DRYVTALWKGIRVGILICYDIEFPESARALGQLGAELILVTNGNMDPYGPVH 174 Query: 181 QVTVRARAQENQCYLVYANYCGAEDE-IEYCGQSSIIGPDGSLLAMAGRDECQLLAELEH 239 + + ARAQENQ + V N G DE + + G S+ + P G L AGR EC+ + EL+ Sbjct: 175 RTAIMARAQENQAFAVMVNRVGDGDEGLVFAGGSAAVDPFGRTLFEAGRAECRQVVELDL 234 Query: 240 ERVVQGRTAFPYLTDLR 256 + + R + YL D R Sbjct: 235 DLLRTARHEYDYLGDRR 251 Lambda K H 0.322 0.139 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 271 Length adjustment: 25 Effective length of query: 239 Effective length of database: 246 Effective search space: 58794 Effective search space used: 58794 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory