Align 5-aminopentanamidase (EC 3.5.1.30) (characterized)
to candidate PP_4463 PP_4463 Carbon-nitrogen hydrolase family protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_2504 (264 letters) >FitnessBrowser__Putida:PP_4463 Length = 273 Score = 94.4 bits (233), Expect = 2e-24 Identities = 84/244 (34%), Positives = 121/244 (49%), Gaps = 24/244 (9%) Query: 1 MRVALYQCPPLPLDVAGNLQRLHQLALEA---KGADLLVLPEMFLTGYNIGIDAVSVLA- 56 M+V+L Q + D A NL +LA EA G+ L+V PE F + G + A Sbjct: 1 MKVSLIQVNSVQ-DKAFNLAEADRLAREAIDRDGSRLVVFPEHF--DWAGGTPEQKIAAG 57 Query: 57 EVHNGESAQQIAR-IAKTTGIAILYG-YPERTEDG-QIYNAVQLIDANGERLCNYRKTHL 113 E H+G A ++ + +A+ + + G + E T DG ++YN + D G L YRK HL Sbjct: 58 EPHSGGPAYEMCKKLAQDCNVYVHTGSFYESTPDGSRVYNTSVVFDPKGNELGRYRKIHL 117 Query: 114 FGDL--------DHSMFSPGPDEFPLVELNGWKLGFLICYDLEFPENARRLALAGAELIL 165 F + + S +PG E +V++ G K GF ICYD+ FPE ++L GA++I+ Sbjct: 118 FDIVTPDGMRYGESSAVAPGT-EVSVVDIEGLKYGFAICYDIRFPELFQKLVALGADVIV 176 Query: 166 VPTANMIPYDFIA-DVTVRARAFENQCYVAYANYCG---HEGEIQYC-GQSSIAAPDGSR 220 +P A + DV RARA E QCY G GE +Y G S + P G Sbjct: 177 LPAAFTLQTGKDHWDVLCRARAIETQCYFLAPGQTGPFEQSGETRYSYGHSLVCDPWGHI 236 Query: 221 IAQA 224 IA+A Sbjct: 237 IAKA 240 Lambda K H 0.322 0.140 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 273 Length adjustment: 25 Effective length of query: 239 Effective length of database: 248 Effective search space: 59272 Effective search space used: 59272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory