Align 1-piperideine-2-carboxylate/1-pyrroline-2-carboxylate reductase (NADPH) (EC 1.5.1.21); thiomorpholine-carboxylate dehydrogenase (EC 1.5.1.25) (characterized)
to candidate PP_4431 PP_4431 Ornithine cyclodeaminase 1
Query= BRENDA::Q14894 (314 letters) >FitnessBrowser__Putida:PP_4431 Length = 330 Score = 115 bits (288), Expect = 1e-30 Identities = 96/323 (29%), Positives = 154/323 (47%), Gaps = 21/323 (6%) Query: 8 LSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSA 67 L+ E+ E + + I +E A A+ + G V+ P + +++H G + V AY Sbjct: 7 LNQREIRECVTLDTDSIDVVENAFASLARGK---VVMPSILRLDISEHNGEVDVKTAYLP 63 Query: 68 AEDALTTKLVT-FYEDRGITSVVPSHQATVLLFEPSNGTLLAVM-DGNVITAKRTAAVSA 125 + K+ F+ + G+ +PS ++L G L A++ D +TA RTAA A Sbjct: 64 DLENFAIKVSPGFFNNPGLG--LPSLNGMMMLLSGRTGLLQALLLDNGYLTAVRTAAAGA 121 Query: 126 IATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQG-- 183 +A ++L SE + +LGAG QA + K VR+W R+ A++ A + Sbjct: 122 VAARWLARQDSEEVALLGAGEQAELQLKALLLVRDIKRVRVWARSSAKAQQLALQLSSLY 181 Query: 184 --EVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELM 241 E SV EA++ AD+ +T T + +PIL ++PG HI A+GA E+ E++ Sbjct: 182 GLEATAAESVDEAMSSADIAVTCTPSNQPILHRRHLRPGLHITAMGADTEHKNEVAPEVI 241 Query: 242 KEAVLYVD---SQEAALKESGDVLLSGA----EIFAELGEVIKGVKPAHCEKT--TVFKS 292 YV SQ A L E + +G ++AELG+VI G + T T+ Sbjct: 242 AAVDHYVADRVSQTATLGELHHAINAGVAQDLRVYAELGQVILGDRVGRLTPTDVTLCDL 301 Query: 293 LGMAVEDTVAAKLIYD-SWSSGK 314 G V+DT A L + + S+GK Sbjct: 302 TGTGVQDTAIANLAFSRAISTGK 324 Lambda K H 0.315 0.130 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 330 Length adjustment: 28 Effective length of query: 286 Effective length of database: 302 Effective search space: 86372 Effective search space used: 86372 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory