GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ydiJ in Pseudomonas putida KT2440

Align D-2-hydroxyglutarate dehydrogenase (EC 1.1.99.39) (characterized)
to candidate PP_3745 PP_3745 glycolate oxidase, putative FAD-linked subunit

Query= BRENDA::Q8N465
         (521 letters)



>lcl|FitnessBrowser__Putida:PP_3745 PP_3745 glycolate oxidase,
           putative FAD-linked subunit
          Length = 499

 Score =  165 bits (418), Expect = 3e-45
 Identities = 134/446 (30%), Positives = 208/446 (46%), Gaps = 19/446 (4%)

Query: 83  EALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPV 142
           E L+    D L   R    ++  P   E+V  +L+ CH+R + V  +G  TG+ GG++P+
Sbjct: 39  EDLKPYECDGLSAYRTVPLLVALPERLEQVQTLLKLCHQRGVPVVARGAGTGLSGGALPL 98

Query: 143 FDEIILSTARMNRVLSFHSVSGILVCQAGCVLEELSRYVEERDFIMPLDLGAKGSCHIGG 202
              I+L  AR NR+L  +        Q G     +S+           D  ++ +C IGG
Sbjct: 99  AKGILLVMARFNRILEVNPQGRYARVQPGVRNLAISQAAAPHGMYYAPDPSSQIACSIGG 158

Query: 203 NVATNAGGLRFLRYGSLHGTVLGLEVVLADGTVLDCLTSLRKDNTGYDLKQLFIGSEGTL 262
           NVA NAGG+  L+YG     VL ++++  +G  L  L S   D+ G+DL  LFIGSEG L
Sbjct: 159 NVAENAGGVHCLKYGLTVHNVLKVDILTVEGERLS-LGSDALDSPGFDLLALFIGSEGML 217

Query: 263 GIITTVSILCPPKPRAVNVAFLGCPGFAEVLQTFSTCKGMLGEILSAFEFMDAVCMQLVG 322
           GI+T V++   PKP+   V         +  +  +      G I    E MD + ++   
Sbjct: 218 GIVTEVTVKLLPKPQVARVILASFDSVEDAGRAVADIIA-AGIIPGGLEMMDNLAIRAAE 276

Query: 323 RHLHLASPVQESPFYVLIETSGSNAG--HDAEKLGHFLEHALGSGLVTDGTMATDQRKVK 380
             +H   PV ++   +L E  G  A    D E++   L  A G+  V    +A D+ +  
Sbjct: 277 DFIHAGYPV-DAAAILLCELDGVEADVYDDCERVAAVLTQA-GAREV---HLACDEAERA 331

Query: 381 MLWALRERITEALSR-DGYVYKYDLSLP---VERLYDIVTDLRARLGPHAKHVVGYGHLG 436
             WA R+    A+ R     Y  D ++P   + R+   ++DL A  G    +V    H G
Sbjct: 332 RFWAGRKNAFPAVGRISPDYYCMDGTIPRRELPRVLKGISDLSAEYGLRVANVF---HAG 388

Query: 437 DGNLHLNVTAEAFSPSLL---AALEPHVYEWTAGQQGSVSAEHGVGFRKRDVLGYSKPPG 493
           DGN+H  +  +A  P  L    A+   + E      GS++ EHGVG  K + +       
Sbjct: 389 DGNMHPLILFDANLPGELERAEAIGGKILELCVKVGGSITGEHGVGREKINQMCAQFNSD 448

Query: 494 ALQLMQQLKALLDPKGILNPYKTLPS 519
            + L   +KA  DP+G+LNP K +P+
Sbjct: 449 EITLFHAVKAAFDPQGLLNPGKNIPT 474


Lambda     K      H
   0.321    0.139    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 689
Number of extensions: 27
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 521
Length of database: 499
Length adjustment: 34
Effective length of query: 487
Effective length of database: 465
Effective search space:   226455
Effective search space used:   226455
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory