Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate PP_1018 PP_1018 mannose/glucose ABC transporter - ATP binding subunit
Query= reanno::Smeli:SMc03065 (362 letters) >FitnessBrowser__Putida:PP_1018 Length = 384 Score = 278 bits (711), Expect = 2e-79 Identities = 164/368 (44%), Positives = 226/368 (61%), Gaps = 15/368 (4%) Query: 1 MTGLLLKDIRKSYGA--VDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGG 58 M L L+++ K+YG+ D + I L IK+GEF++ VGPSGCGKSTL+ IAGLE+ITGG Sbjct: 1 MATLELRNVNKTYGSGLPDTLKDIQLSIKDGEFLILVGPSGCGKSTLMNCIAGLEQITGG 60 Query: 59 DMFIDGERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAA 118 + ID + V+ + P R IAMVFQSYALYP M+V +N+ FG++I + + ID V A Sbjct: 61 AILIDEQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKLPQAAIDEEVARVA 120 Query: 119 DMLQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAK 178 +LQ+ L R P LSGGQ+QRVA+GRA+ R PK++LFDEPLSNLDA LRV R E+ Sbjct: 121 KLLQIEHLLARKPAQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 Query: 179 LSERMSDTTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSP 238 + +R+ TT +YVTHDQ+EAMTL D++ V+ G I+Q G P ++Y PAN FVA FIGSP Sbjct: 181 MHQRLK-TTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPQQIYNDPANQFVASFIGSP 239 Query: 239 AMNVIPATITATGQQTAVSLAGGKS---VTLDVPTNASENGKTASFGVRPEDLRVTEADD 295 MN IP + + L G++ + L +A E G+ G+RPE + + AD Sbjct: 240 PMNFIPVRLARQDGRLLALLDSGQARCELPLGEAADALE-GREIILGIRPEQIALGAADG 298 Query: 296 F---LFEGTVSIVEALGEVTLLYIEGLVENEPIIAKMPGIA-RVGRGDKVRFTADKAKLH 351 V + E G L+++ L + + P +A RV GD + D A++ Sbjct: 299 NGLPAIRAEVQVTEPTGPDLLVFVT-LNQTKVCCRLAPDVACRV--GDTLNLQFDPARVL 355 Query: 352 LFD-TNGQ 358 LFD NG+ Sbjct: 356 LFDAANGE 363 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 384 Length adjustment: 30 Effective length of query: 332 Effective length of database: 354 Effective search space: 117528 Effective search space used: 117528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory