Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; EC 1.1.1.138 (characterized)
to candidate PP_1951 PP_1951 Oxidoreductase, short chain dehydrogenase/reductase family
Query= SwissProt::O93868 (262 letters) >FitnessBrowser__Putida:PP_1951 Length = 275 Score = 116 bits (291), Expect = 4e-31 Identities = 82/263 (31%), Positives = 143/263 (54%), Gaps = 27/263 (10%) Query: 14 IIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAKDAVEVTEKVGKEFGVKTKAYQCDVSNT 73 +IVTG G+GLAFT A+A +GA VA++ + ++A++ + + G +++ DV++ Sbjct: 14 VIVTGAASGLGLAFTEAMAESGAQVAMLDLN-REALDAQFRRLRSLGYSVRSHVLDVTDR 72 Query: 74 DIVTKTIQQIDADLGAISGLIANAGVSVV------------KPAT---ELTHEDFKFVYD 118 D V T + A G + + ANAG+ +PA E + ++ V Sbjct: 73 DAVDDTFNAVAAGFGGLDIVFANAGIDPGPGFAALNAAGEREPANMLEEYSDHRWRKVIS 132 Query: 119 VNVFGVFNTCRAVAKLWLQKQQKGSIVVTSSMSSQIINQSSLNGSLTQ-VFYNSSKAACS 177 V++ VF + RA A+ ++ + GSI+VT+S+S+ L ++T Y ++KA + Sbjct: 133 VSLDAVFYSIRAAAR-HMRANRSGSIIVTTSVSA-------LRPAVTLGAAYAAAKAGAA 184 Query: 178 NLVKGLAAEWASAGIRVNALSPGYVNTDQTAHM--DKKIRDHQASNIPLNRFAQPEEMTG 235 LV+ A E AS G+RVNA++PG TD + ++R A+ +P+ R A+ EE+ Sbjct: 185 QLVRATALELASDGVRVNAIAPGPFETDIGGGFMHNSEVRAKMAAGVPMGRIAEVEEIKP 244 Query: 236 QAILLLSDHATYMTGGEYFIDGG 258 A+ L S ++++TG ++ IDGG Sbjct: 245 LALYLASKASSFVTGQQFVIDGG 267 Lambda K H 0.317 0.130 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 275 Length adjustment: 25 Effective length of query: 237 Effective length of database: 250 Effective search space: 59250 Effective search space used: 59250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory