Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; EC 1.1.1.138 (characterized)
to candidate PP_2794 PP_2794 Oxidoreductase, short chain dehydrogenase/reductase family
Query= SwissProt::O93868 (262 letters) >FitnessBrowser__Putida:PP_2794 Length = 255 Score = 113 bits (282), Expect = 4e-30 Identities = 78/248 (31%), Positives = 126/248 (50%), Gaps = 15/248 (6%) Query: 15 IVTGGNRGIGLAFTRAVAAAGANVAVIYRSAKDAVEVTEKVGKEFGVKTKAYQCDVSNTD 74 +VTG + G+G F +AAAGA V V R + E + + G + +A+ DV++ + Sbjct: 17 LVTGASSGLGRHFAMTLAAAGAEVVVTARRQAPLQALVEAI-EVAGGRAQAFALDVTSRE 75 Query: 75 IVTKTIQQIDADLGAISGLIANAGVSVVKPATELTHEDFKFVYDVNVFGVFNTCRAVAKL 134 + + + G + L+ NAGVS +P + + V D N+ G + + A+ Sbjct: 76 DICRVLDAA----GPLDVLVNNAGVSDSQPLLACDDQTWDHVLDTNLKGAWAVAQESARR 131 Query: 135 WLQKQQKGSIV-VTSSMSSQIINQSSLNGSLTQVFYNSSKAACSNLVKGLAAEWASAGIR 193 + + GS++ VTS ++S++ Y ++KA ++L + +A E A GIR Sbjct: 132 MVVAGKGGSLINVTSILASRVAGAVGP--------YLAAKAGLAHLTRAMALELARHGIR 183 Query: 194 VNALSPGYVNTD-QTAHMDKKIRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGE 252 VNAL+PGYV TD A + + D S IP RF+ P ++ G +LL SD M+G E Sbjct: 184 VNALAPGYVMTDLNEAFLASEAGDKLRSRIPSRRFSVPSDLDGALLLLASDAGRAMSGAE 243 Query: 253 YFIDGGQL 260 +DGG L Sbjct: 244 IVVDGGHL 251 Lambda K H 0.317 0.130 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 255 Length adjustment: 24 Effective length of query: 238 Effective length of database: 231 Effective search space: 54978 Effective search space used: 54978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory