Align SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate PP_0411 PP_0411 Polyamine ABC transporter, ATP-binding protein
Query= TCDB::P54933 (332 letters) >FitnessBrowser__Putida:PP_0411 Length = 374 Score = 240 bits (613), Expect = 4e-68 Identities = 131/320 (40%), Positives = 184/320 (57%), Gaps = 32/320 (10%) Query: 4 ITLRNVQKRF-GEAVVIPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDVSDGQIMI 62 ++ R VQK + GE++++ L+LDI GEF+ +GPSG GK+T L ++AG E + G+I + Sbjct: 15 VSFRGVQKSYDGESLIVKDLNLDIRKGEFLTLLGPSGSGKTTSLMMLAGFETPTAGEIQL 74 Query: 63 DGRDATEMPPAKRGLAMVFQSYALYPHMTVKKNIAFPLRMAKMEPQEIERRVSNAAKILN 122 GR +PP KR + MVFQ+YAL+PHMTV +N+AFPL + + +I RV ++ Sbjct: 75 GGRSINNVPPHKRDIGMVFQNYALFPHMTVAENLAFPLTVRNLSKTDISERVKRVLNMVQ 134 Query: 123 LTNYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVNMRLEITELHQS 182 L + R PGQLSGGQ+QRVA+ RA+V EP L DEPL LD LR +M++EI +HQ Sbjct: 135 LDAFAKRYPGQLSGGQQQRVALARALVFEPQLVLMDEPLGALDKQLREHMQMEIKHIHQR 194 Query: 183 LETTMIYVTHDQVEAMTMADKIVVLNAGRIEQVGSPLTLYRNPANLFVAGFIGSPKMNLI 242 L T++YVTHDQ EA+TM+D++ V + G I+Q+ P TLY P N FVA FIG + N I Sbjct: 195 LGVTVVYVTHDQGEALTMSDRVAVFHQGEIQQIADPRTLYEEPCNTFVANFIG--ENNRI 252 Query: 243 EGPEAAKHG-------------------------ATTIGIRPEHIDLSREA----GAWEG 273 G A G T+ IRPE + L+ + + G Sbjct: 253 SGTLLASDGKRCQVQLPRGERVEALAVNVGQAGEPVTLSIRPERVRLNGHSESCVNRFSG 312 Query: 274 EVGVSEHLGSDTFLHVHVAG 293 V +LG + + V G Sbjct: 313 RVAEFIYLGDHVRVRLEVCG 332 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 374 Length adjustment: 29 Effective length of query: 303 Effective length of database: 345 Effective search space: 104535 Effective search space used: 104535 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory