Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate PP_0878 PP_0878 dipeptide ABC transporter, binding subunit
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__Putida:PP_0878 Length = 322 Score = 265 bits (677), Expect = 1e-75 Identities = 128/319 (40%), Positives = 203/319 (63%), Gaps = 2/319 (0%) Query: 8 IKMKPLLQTVDLKKYFPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLL 67 + + L + ++ + +G +++A++G+S E++ G+TL +VGESGCGKSTL R + + Sbjct: 5 LSARELTRHYEVSRGLFKGHALVRALNGVSFELEAGKTLAVVGESGCGKSTLARALTLIE 64 Query: 68 RPDGGKIFFEGKDITNLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKIG 127 P G + G ++ + E K R+ +Q++FQ P SLNP+ +G + +PL+I+ Sbjct: 65 EPSSGSLQIAGTEVKGASKAERKQLRRDVQMVFQSPYASLNPRQKIGDQLAEPLLINTSL 124 Query: 128 TKKERRKRVEELLDMVGIGREFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSAL 187 +K ERR +V+++++ VG+ E +PH FSGGQ+QRI +ARA+ L PK +V DEP SAL Sbjct: 125 SKAERRDKVQKMMEQVGLRPEHYQRYPHMFSGGQRQRIALARAMMLQPKVLVADEPTSAL 184 Query: 188 DVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFLN 247 DVSIQAQ+++L ++Q++ +Y+FI+HNLAVV H++ +V VMYLG+ E G + I+ Sbjct: 185 DVSIQAQVLNLFMDLQKEFNTAYVFISHNLAVVRHVADQVLVMYLGRPAEMGPKEDIYAK 244 Query: 248 PIHPYTRALLKSVPKIPWDGQKQRFYSLKGELPSPIDLPKGCRFQTRCTEKKAICFEKEP 307 P+HPYT+ALL + P I D K + + GELP+P++ P GC F RC C ++ P Sbjct: 245 PLHPYTQALLSATPAIHPDPLKPKI-RIVGELPNPLNPPDGCAFHKRCPYATERCAKEVP 303 Query: 308 ELTEVEKNHFVSCHLVRSY 326 L +V V+CH + Sbjct: 304 ALRQVSTRQ-VACHYAEQF 321 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 322 Length adjustment: 28 Effective length of query: 300 Effective length of database: 294 Effective search space: 88200 Effective search space used: 88200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory