Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate PP_4453 PP_4453 glutathione ABC transporter ATP-binding subunit
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__Putida:PP_4453 Length = 610 Score = 228 bits (580), Expect = 4e-64 Identities = 123/251 (49%), Positives = 169/251 (67%), Gaps = 4/251 (1%) Query: 32 AVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRPDGGKIFFEGKDITNLNDKEMKP 91 AV+ +S + +GETL +VGESGCGKST GR I LL P G + EG ++ ++ E Sbjct: 334 AVENVSFNLSQGETLAIVGESGCGKSTTGRLITGLLDPTHGSVKLEGVELGSITPMERA- 392 Query: 92 YRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKIGTKKERRKRVEELLDMVGIGREFIN 151 +K+Q++FQDP SLNP+ TV + I +PL +H + K + ELL VG+ + Sbjct: 393 --RKIQMVFQDPYSSLNPRQTVAQSIIEPLRVHGLYDAKRCEEVAIELLVKVGLPADAAW 450 Query: 152 SFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSALDVSIQAQIIDLLEEIQQKMGISYL 211 PHEFSGGQ+QR+ IARALAL P IV DE VSALDVS++ QI++LL E+QQ++G+ ++ Sbjct: 451 RLPHEFSGGQRQRVCIARALALRPGTIVADEAVSALDVSVKVQIVNLLLELQQELGLGFI 510 Query: 212 FIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFLNPIHPYTRALLKSVPKIPWDGQKQR 271 FI+H++AVVE +SH+VAVMY+G+IVE G IF +P HPYTR L+ +VP IP +KQ Sbjct: 511 FISHDMAVVERVSHRVAVMYMGEIVEIGPRAAIFNDPKHPYTRRLIDAVP-IPDPARKQV 569 Query: 272 FYSLKGELPSP 282 G L +P Sbjct: 570 QRVSAGTLRTP 580 Score = 181 bits (460), Expect = 3e-50 Identities = 101/263 (38%), Positives = 160/263 (60%), Gaps = 7/263 (2%) Query: 8 IKMKPLLQTVDLKKYFPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLL 67 + + +L+ L F +G V +S + GETL +VGESG GKS +IL LL Sbjct: 7 LNQETVLEVTGLNVAFRRGGGWSPVVKDLSFRVARGETLAIVGESGSGKSVSAMSILGLL 66 Query: 68 RPDG----GKIFFEGKDITNLNDKEMKPYR-KKMQIIFQDPLGSLNPQMTVGRIIEDPLI 122 + G I +G+++ L + EM R ++ +IFQ+P+ SLNP MT+G I +PL Sbjct: 67 PANTSQVTGSIRLQGQELLCLPEPEMADIRGNRIAMIFQEPMTSLNPVMTIGEQIAEPLR 126 Query: 123 IHKIGTKKERRKRVEELLDMVGI--GREFINSFPHEFSGGQQQRIGIARALALNPKFIVC 180 +H+ + ++ +L++ V I +E + +PH+FSGG +QR+ IA ALA NP ++ Sbjct: 127 LHRGLDATQAKEEALKLMERVRIPAAQERYDDYPHQFSGGMRQRVMIAMALACNPAVLIA 186 Query: 181 DEPVSALDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGD 240 DEP +ALDV+IQAQI++L++E+Q + ++ +FI H++ VV I+ + VMY G +VE Sbjct: 187 DEPTTALDVTIQAQILELIKELQAQEHMAVVFITHDMGVVAQIADRTLVMYRGDLVETAS 246 Query: 241 VDKIFLNPIHPYTRALLKSVPKI 263 +IF P PYT+ALL +VP++ Sbjct: 247 TSEIFSAPQKPYTKALLSAVPEL 269 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 525 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 328 Length of database: 610 Length adjustment: 32 Effective length of query: 296 Effective length of database: 578 Effective search space: 171088 Effective search space used: 171088 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory