Align Inositol transport system ATP-binding protein (characterized)
to candidate PP_2759 PP_2759 ribose ABC transporter - ATP-binding subunit
Query= reanno::Phaeo:GFF717 (261 letters) >FitnessBrowser__Putida:PP_2759 Length = 512 Score = 147 bits (371), Expect = 4e-40 Identities = 90/245 (36%), Positives = 134/245 (54%), Gaps = 10/245 (4%) Query: 3 MSQPLIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKG 62 MS P++ ++GI K FG+ AL G S+ V G H L+G+NGAGKST IK ++G+H+P G Sbjct: 1 MSTPVLELRGIVKTFGATRALDGASLRVAAGSVHGLVGENGAGKSTLIKVLAGIHRPDAG 60 Query: 63 DILFEGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHD 122 +L +GQP PR GI +HQ + +V F G+E R+ GP L D Sbjct: 61 SLLLDGQPHGHFSPRQVERLGIGFIHQERLLPARFTVGEALFFGHE--RRFGP--LLDRR 116 Query: 123 YANRITMEEMRKMG--INLRGPDQA-VGTLSGGERQTVAIARAVHFGAKVLILDEPTSAL 179 R E R + LR P A +G LS E+Q V I RA+ +VL+ DEP+ AL Sbjct: 117 SQQR---EAARLLDDYFGLRLPANALIGELSSAEQQMVQIVRALLIKPRVLVFDEPSVAL 173 Query: 180 GVRQTANVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEE 239 R+ +L + ++R G+A+V+I+H ++ A+ DR TVL G+ + + S E+ Sbjct: 174 VQREVERLLRIVQRLRDDGLAIVYISHYLQEIEALCDRVTVLRNGRDVAEVSPRNTSLEQ 233 Query: 240 LQDMM 244 + +M Sbjct: 234 ITRLM 238 Score = 89.7 bits (221), Expect = 1e-22 Identities = 59/234 (25%), Positives = 110/234 (47%), Gaps = 5/234 (2%) Query: 18 GSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILFEGQPLHFADPR 77 G A G+ + V GE L G G+G ++++ G+ P G++ +GQPL PR Sbjct: 265 GRARAYQGIDLQVRRGEIVGLTGLVGSGAKELLRSLFGLAPPDSGEVRLDGQPLSLRSPR 324 Query: 78 DAIAAGIATVHQHLAMIPL---MSVSRNFFMGNEPIRKIGPLKLFDHDYANRITMEEMRK 134 +A+A G+A + + + +SV N + + + L L T+E + + Sbjct: 325 EAVAQGVALMPEERRRQGVALDLSVQENTTLA--ALSRFVRLGLLSPARERHTTLELIER 382 Query: 135 MGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTANVLATIDKV 194 + I G V LSGG +Q VA+A+ + + +LDEP+ + V + I ++ Sbjct: 383 LRIKAHGAHAKVRQLSGGNQQKVALAKWFARCSSLYLLDEPSVGIDVGAKVEIYRLIGEL 442 Query: 195 RKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEELQDMMAGGQ 248 K+G V+ ++ ++ + + DR V++RG G+ +++ L + G Q Sbjct: 443 VKEGAGVLILSSDLPELIGLCDRIHVMHRGAIAARFAAGEANSDRLLAVATGAQ 496 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 261 Length of database: 512 Length adjustment: 29 Effective length of query: 232 Effective length of database: 483 Effective search space: 112056 Effective search space used: 112056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory